KEGG   Citrobacter rodentium: ROD_28981Help
Entry
ROD_28981         CDS       T01145                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cro  Citrobacter rodentium
Pathway
cro00071  Fatty acid degradation
cro00072  Synthesis and degradation of ketone bodies
cro00280  Valine, leucine and isoleucine degradation
cro00310  Lysine degradation
cro00362  Benzoate degradation
cro00380  Tryptophan metabolism
cro00620  Pyruvate metabolism
cro00630  Glyoxylate and dicarboxylate metabolism
cro00640  Propanoate metabolism
cro00650  Butanoate metabolism
cro00900  Terpenoid backbone biosynthesis
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01130  Biosynthesis of antibiotics
cro01200  Carbon metabolism
cro01212  Fatty acid metabolism
cro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROD_28981
   00630 Glyoxylate and dicarboxylate metabolism
    ROD_28981
   00640 Propanoate metabolism
    ROD_28981
   00650 Butanoate metabolism
    ROD_28981
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ROD_28981
   00072 Synthesis and degradation of ketone bodies
    ROD_28981
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROD_28981
   00310 Lysine degradation
    ROD_28981
   00380 Tryptophan metabolism
    ROD_28981
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROD_28981
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROD_28981
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_28981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cro04147]
    ROD_28981
Enzymes [BR:cro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ROD_28981
Exosome [BR:cro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROD_28981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBG89636
UniProt: D2TJJ8
Position
complement(3068952..3070130)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVDLGSMVVKALIESSGVDANAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDAGRFKAEIVPVLTQRNGQTVIVDTDEQPRTDASAEGLARLDPAFALSGS
VTAGNASSINDGAAAVMMMSEAKAQELNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtcggggcgttgcgaacgccaattggttgctttcaggggacg
ctggcgcgtcattctgccgtcgatctcggcagcatggtggtgaaggcgctgattgaaagc
agcggcgtggacgcgaacgccgttgatgaagtgattctcggccaggtgctcacggcagga
gccgggcaaaatccggcgcgtcagtccgccattaaaggtggcttgccgaacacggtttct
gctatcaccattaacgacgtctgcggctcggggctgaaagcgctgcatctggcgacgcag
gcgatccagtgcggcgaagcggatatcgtcatcgccggcgggcaggagaacatgagccgg
gcgccgcacgttcttaccgacagccggaccggcgcgcagctgggtaacagccagctcgtc
gacagcctggtgcatgacggtttatgggatgccttcaatgattaccatatcggcgttacc
gccgaaaacctggcgcgtgaatatggcatcagtcgtgagttgcaggacgcgtatgcgctc
agctcccagcaaaaagcgcgggcggccatcgatgccgggcgctttaaagcggagatcgtc
ccggtactgacccagcgtaatggtcagacggtgattgtcgataccgatgaacagccgcga
accgatgccagcgccgaaggcctggcccggctcgatccggcgttcgcgttgagcggatcg
gtgaccgctggcaatgcctcctccatcaacgatggcgcggcggcggtaatgatgatgagc
gaagcgaaagctcaggaactgaatttaccggtactggcgcgtattcgcgcattcgccagc
gtcggcgtggatcctgcgctgatgggcattgccccggtctatgcaacccgccgctgtctg
gaacgggtcggctggcaattggccgatgtcgatcttattgaggcgaacgaagcctttgcg
gcgcaggcgctgtcggtcggtaaaatgcttgagtgggacgagcggcgggtgaacgtcaac
ggcggggcgattgccttaggtcaccctattggcgcctccggctgtcggatactggtgtcg
ctggtgcatgagatgattaagcgtgatgcccgtaaaggtctggcgacactctgcatcggc
ggagggcagggcgtggcgttagccatcgaacgcgattag

DBGET integrated database retrieval system