KEGG   Citrobacter rodentium: ROD_34171
Entry
ROD_34171         CDS       T01145                                 

Gene name
cts2S
Definition
(GenBank) T6SS protein Cts2S
  KO
K11901  type VI secretion system protein ImpB
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_34171 (cts2S)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_34171 (cts2S)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CBG90130
UniProt: D2TPU5
Position
3598320..3598832
AA seq 170 aa
MAESIQHKLNQIRPPRVQITYDVETGGAVEKKELPMVVGILADLSGQPASPPQKLRERRF
VEIDRDNFDDVLSSISPRLAIQVDNRLANDDSKLNVELNFRTFEDFTPLNIINQVKPLQR
LFLARQRLRDLLTKLDGNDDLDTLLQQVVNDNAELQALRPAEKNSTTENV
NT seq 513 nt   +upstreamnt  +downstreamnt
atggccgaaagcattcaacataaactcaaccaaataagaccgccgcgcgttcaaattacc
tatgacgtggaaaccggcggggccgttgagaaaaaagaactgcctatggtggtggggatt
ctggccgatctgtccggtcagccagcctccccgccgcagaaacttcgcgaacgtcgcttc
gtcgaaatcgaccgcgataactttgatgacgtactttcctcgatctccccccgcctggcg
attcaggtggataaccgcctggcgaacgatgacagcaagctcaacgttgaactgaatttc
agaacattcgaagactttacccctctcaacattatcaaccaggttaagccgcttcagcgt
ctttttcttgcccgccagcgcctgcgcgatctgttgaccaagctggacggcaacgacgat
ctggacacgctgctgcagcaggtggtcaatgacaatgcggagctgcaggcgctgcgtccg
gcagagaaaaactctacgacggaaaacgtttaa

DBGET integrated database retrieval system