KEGG   Citrobacter rodentium: ROD_34191Help
Entry
ROD_34191         CDS       T01145                                 

Gene name
cts2H
Definition
(GenBank) Hcp family T6SS protein Cts2H
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_34191 (cts2H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_34191 (cts2H)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_34191 (cts2H)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CBG90132
UniProt: D2TPU7
Position
3600351..3600836
Genome map
AA seq 161 aa AA seqDB search
MDAIFLKLEGIDGESLVKGFEKQLEIMSYSHNVAMQVTNDVSNTERTSGRAHVGEFSLTK
FVDLSTPVLNEYCCCGKVIPTAVLTLCRNDNGNMLPFIVYTLNNVIISQLNVSGGSGGKP
VETMSLNFTKIKWEITAQKSAGQKEGNSSSVWDMAMNQKGR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatttttttaaagctggaaggcattgatggcgagagcttggtaaaaggattt
gagaaacagctcgagatcatgtcctacagccataacgtggcgatgcaggtgacgaacgac
gtcagtaacaccgagcgcacctccgggcgcgcccatgttggcgaattttctctgaccaag
tttgtcgatctctctaccccggtgctcaacgaatactgctgctgcgggaaggtgatcccc
acggcggtactgacgctgtgccgtaacgacaatggcaatatgctgccgtttattgtctac
accttaaacaatgtcattatttctcagctcaacgtcagcggcggatccggcggtaagcca
gtggagacaatgtcgctgaacttcaccaaaatcaaatgggagatcaccgctcagaaatcg
gccgggcaaaaagagggtaactcttcttccgtttgggatatggcgatgaaccagaaaggg
cgttga

DBGET integrated database retrieval system