KEGG   Citrobacter rodentium: ROD_38501Help
Entry
ROD_38501         CDS       T01145                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
cro  Citrobacter rodentium
Pathway
cro00010  Glycolysis / Gluconeogenesis
cro00071  Fatty acid degradation
cro00350  Tyrosine metabolism
cro00625  Chloroalkane and chloroalkene degradation
cro00626  Naphthalene degradation
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01130  Biosynthesis of antibiotics
cro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_38501
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ROD_38501
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ROD_38501
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ROD_38501
   00626 Naphthalene degradation
    ROD_38501
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ROD_38501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CBG90554
UniProt: D2TU88
Position
4056783..4057931
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVNLVANKQWGKALIVTDGQLVKLGLLDSLFTALDAHQMA
YHLFDEVFPNPTEALVQKGYAAYQAANCDYIIAFGGGSPIDTAKAVKILTANPAPSTAYS
GVGKVKNPGVPLVAINTTAGTAAEMTSNAVIIDSERQVKEVIIDPNIIPDIAVDDASVML
NIPPSVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGQNMEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
RIAEAMGVDTRGMSDEAASMEAINAIRALSKRVGIPEGFSKLGVTKEDIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgctggcacttccgaaaatcagtctgcacggcgcaggggcgattggcgat
atggtgaatctggtcgccaataagcagtggggcaaggcgctgatcgtcaccgacggtcaa
ctggtgaagctggggctgctcgacagcctgtttaccgcgctggacgcgcatcagatggct
tatcacctgtttgatgaggtcttcccgaacccgaccgaagcgctggtgcaaaaaggctat
gcggcgtaccaggcggcgaactgcgactacatcatcgcgtttggcggcggcagcccgatc
gacactgcgaaagcggtgaaaattctcaccgccaacccggcgccgtccaccgcctactcc
ggcgtcggcaaggtgaaaaatccgggcgtaccgttggtggcgattaacaccaccgccggc
acggcggcggaaatgaccagtaacgcagtgattatcgactccgaacgtcaggtgaaagaa
gtgatcatcgacccgaatatcatcccggatatcgccgtcgacgatgccagcgtaatgctc
aatattccgccgtccgtaactgcggcaaccggtatggacgcgttgacccacgcggtggaa
gcgtatgtctctgtcggcgcgcacccgctgaccgacgccaacgcgctggaagccattcgc
ctgattaacctgtggctgccgaaagcagtcgatgacggccagaacatggaagcccgcgag
cagatggcgtttggtcagtatctggcggggatggcgtttaacagcgccggtctggggctg
gttcatgcgctggcgcaccagccgggcgcgactcataatctgccgcacggcgtgtgcaac
gccatcctgctgccgattatcgaaaactttaaccgcccgaacgccgtcgcgcgttttgcc
cgcatcgccgaagcgatgggcgtcgacacccgcggcatgagcgacgaagcggcaagtatg
gaagccatcaacgcgatccgcgccctcagcaagcgcgtagggattccggaagggttcagc
aagctcggcgtaaccaaagaggatattgagggctggctggataaagcgctggccgatcca
tgcgcgccgtgcaacccgcgcaccgccagccgcgatgaagtgcgtgaactgtatctggag
gcgttatga

DBGET integrated database retrieval system