KEGG   Citrobacter rodentium: ROD_39471Help
Entry
ROD_39471         CDS       T01145                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cro  Citrobacter rodentium
Pathway
cro00860  Porphyrin and chlorophyll metabolism
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
Module
cro_M00121  Heme biosynthesis, glutamate => heme
cro_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ROD_39471 (hemD)
Enzymes [BR:cro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ROD_39471 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 HAD
Motif
Other DBs
NCBI-ProteinID: CBG90650
UniProt: D2TV26
Position
4168832..4169572
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEALVSRLRTLGLEAWSFPLIEFTPGRDLPLLGDALAALTDNDLLFALS
QHAVSFAHAQLERQGGKWPAAPRYFAIGRTTALALHTVSGHDIRYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELLGETLTARGADVAFCECYQRSAKHYDGAEEAMRWQARGVT
TVVVTSGEMLQQLAALIPQWYRENWLLRCRLLVVSERLAHLARELGWQDIQVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcacccgcccgtctcccgcaggggaagcattagtgagccgtctgcgc
acactggggctggaggcctggagttttccgctcattgaatttacgccgggccgcgatctg
ccgctgctgggcgatgcgctggcggcgcttaccgataacgatctgctgtttgcgctgtcg
cagcatgccgtctcgtttgcccatgctcagctggaacgacaaggcggaaaatggcccgcc
gctccgcgctatttcgccattggccgcactaccgcgctggcgctgcataccgttagcggc
cacgatattcgctatcctcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggtaaacgcgcgctgattttacgcggtaacggcggtcgggaactg
ctgggggaaaccctgacggcgcgcggtgccgacgtcgctttctgtgaatgctatcagcgc
agcgcgaagcattatgatggcgcggaagaggcgatgcgctggcaggcgcgcggggtgacg
acggtggttgtcaccagcggcgaaatgctgcaacagctcgccgcgctgatcccgcagtgg
tatcgcgaaaactggttactccgctgtcggcttcttgtcgtcagcgagcgtctggcgcac
ctcgcccgggaactgggctggcaagatattcaggtcgccgataacgccgacaacgatgcg
ctactgcgcgcattacaataa

DBGET integrated database retrieval system