KEGG   Citrobacter rodentium: ROD_41981Help
Entry
ROD_41981         CDS       T01145                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
cro  Citrobacter rodentium
Pathway
cro00540  Lipopolysaccharide biosynthesis
cro01100  Metabolic pathways
Module
cro_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ROD_41981 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cro01005]
    ROD_41981 (rfaD)
Enzymes [BR:cro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     ROD_41981 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:cro01005]
 Unusual sugar
  ROD_41981 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short
Motif
Other DBs
NCBI-ProteinID: CBG90896
UniProt: D2TIY4
Position
complement(4426133..4427113)
Genome map
AA seq 326 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MAGEEFGEIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEADSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGETPKLFEGSENFKRDFVYVGDVADVNLWFWENGVSGIYNLGTGRA
ESFQAVADATLAFHKKGEIEYIPFPEKLKGRYQAFTQADLTNLRTAGYDKPFKTVAEGVT
EYMAWLNRDSDTNSQNHSSGIKAATK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggctttatcggcagcaacattgttaaggccctgaat
gataaaggcatcaccgatatcctggtggtggacaacctgaaagacggcaccaagtttgtt
aacctggtggatctgaacattgccgattatatggataaagaagatttcttaatccagatt
atggcgggtgaagagttcggcgagatcgaagccattttccacgaaggcgcttgctcctcc
accaccgagtgggacggcaagtacatgatggataacaactatcagtactccaaagagctg
ctgcactattgcctggagcgcgagatcccgttcctgtacgcctcttccgccgccacctac
ggcggtcgcacctccgactttattgaatcccgtgaatatgagaagccgctgaatgtctac
ggctactcgaagtttctgtttgacgaatacgtgcgtcagattctgccggaagccgattcg
cagatcgtgggcttccgctatttcaacgtctacgggccgcgtgaagggcataaaggcagc
atggcgagcgtcgctttccatctcaacacccagttgaataacggcgaaacgccgaagctg
tttgaaggcagcgaaaactttaagcgtgacttcgtctacgtgggcgatgtggctgatgta
aatctgtggttctgggaaaacggcgtgtccggtatctataacctcggcaccggtcgcgcg
gaatccttccaggcggtggctgacgcgacgctggccttccataaaaaaggcgagattgag
tacatcccgttcccggaaaaactgaaaggccgctatcaggcatttactcaggcggatctg
acgaatctgcgcactgcgggctacgacaagccgtttaagaccgttgccgaaggcgtaacg
gagtatatggcctggctgaaccgcgacagcgatacaaattcacaaaatcattcgagcggt
atcaaggcggcaaccaagtga

DBGET integrated database retrieval system