KEGG   Citrobacter rodentium: ROD_48731Help
Entry
ROD_48731         CDS       T01145                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
cro  Citrobacter rodentium
Pathway
cro00230  Purine metabolism
cro00240  Pyrimidine metabolism
cro01100  Metabolic pathways
cro03030  DNA replication
cro03430  Mismatch repair
cro03440  Homologous recombination
Module
cro_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ROD_48731 (holD)
   00240 Pyrimidine metabolism
    ROD_48731 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ROD_48731 (holD)
   03430 Mismatch repair
    ROD_48731 (holD)
   03440 Homologous recombination
    ROD_48731 (holD)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ROD_48731 (holD)
DNA replication proteins [BR:cro03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ROD_48731 (holD)
DNA repair and recombination proteins [BR:cro03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     ROD_48731 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: CBG91559
UniProt: D2TRW7
Position
5144628..5145041
Genome map
AA seq 137 aa AA seqDB search
MTTRRDWQLQQLGITQWSLRRPGALQGEIAISIPAHIRLVMVAEEPPALTEPLVSDILRA
LTLTPDQVLQVTPERVAMLPQGSRCNSWRLGTEEPLLLEGAQVTTPGLDELRANPAARAA
LWQQICTHEHDFFPSRE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccgacgagactggcagttacaacagctgggcattacccagtggtcgctgcgt
cgccccggcgcgttgcagggagagatcgccatttccattcctgcgcatatccgtctggtg
atggtcgctgaagagccgccggcgctgactgaaccgctggtaagcgatattctgcgggcg
ttaaccctcactcccgaccaggtgttgcaggtgacgccggaacgtgtcgccatgctgccg
cagggcagtcgctgcaacagctggcgtctgggaacggaggagccgctgctgctggaaggc
gcgcaggtgaccacgcccggactggatgagctacgggcaaacccagcggcccgcgccgcg
ttatggcaacaaatctgcacacatgaacacgatttcttcccttcgcgagagtga

DBGET integrated database retrieval system