KEGG   Citrobacter rodentium: ROD_49131Help
Entry
ROD_49131         CDS       T01145                                 

Gene name
nadR
Definition
(GenBank) transcriptional regulator
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
cro  Citrobacter rodentium
Pathway
cro00760  Nicotinate and nicotinamide metabolism
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ROD_49131 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cro03000]
    ROD_49131 (nadR)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     ROD_49131 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     ROD_49131 (nadR)
Transcription factors [BR:cro03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ROD_49131 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 HTH_26 CTP_transf_like Citrate_ly_lig MMR_HSR1 HTH_37 Dynamin_N FAD_syn HTH_35 AAA_16
Motif
Other DBs
NCBI-ProteinID: CBG91597
UniProt: D2TRZ9
Position
5176306..5177541
Genome map
AA seq 411 aa AA seqDB search
MSSFDYLKTAIKQKGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RQQKNIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDDTRDRELFEDSAMSQQPTV
PDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKTFMAEKGIQPNWIYTSEE
ADAPQYLEHLGIETVLIDPRRTFMNISGAQIRENPFRYWEYIPTEVKPFFVRTVAVLGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKEFQTLLVEMLRKNNIDFVHVEEADYDGRFLRCVELVKEMMGEQGV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgttcgactatctcaaaaccgccatcaagcagaaaggctgtaccctgcaacaa
gtggcggacgccagcggcatgaccaaagggtatctcagccagcttctcaacgccaaaatc
aaaagccccagcgcgcagaagctggaagcgctgcaccgctttctcggtctggaatttccc
cgccagcagaaaaacatcggcgtggtgttcggcaagttctatccgctgcataccgggcac
atttatctgattcagcgcgcctgtagccaggtggacgagctgcatatcatcatgggttac
gacgatacccgtgaccgcgagctgtttgaagacagcgccatgtcccagcagcccacggtg
ccggatcgtctgcgctggctgttgcaaacctttaaataccagaaaaatatccgcatccac
gccttcaacgaagagggaatggagccgtatccccacggctgggatgtctggagcaacggc
atcaaaacgtttatggccgagaagggtattcagcccaactggatctacacctctgaagag
gccgacgcgccgcagtatctggagcacctggggattgaaacggtgcttatcgatcccaga
cgcacctttatgaacatcagcggggcgcagatccgtgaaaacccgttccgctactgggag
tacattcccacggaagtgaagccgtttttcgtgcgcaccgtggcggtgctcggcggcgag
tcgagcggcaagtcaacgctggttaacaagctggcgaacattttcaataccaccagcgcg
tgggagtacgggcgcgattatgtcttttcgcaccttggcggcgatgagatggcgctccag
tattccgactacgataaaatcgcgctcggtcacgctcagtacatcgattttgccgttaag
tacgccaataaagtggcgtttatcgacaccgattttgtcaccacccaggcattctgcaaa
aagtacgaagggcgtgagcacccctttgtgcaggcgctgattgatgagtaccgctttgat
ctggtgatcctgctggaaaacaataccccgtgggtagctgacggtctgcgcagtctcggc
agttcagtggatcgcaaagagtttcagacgctgctggtggagatgttgcgcaaaaacaac
atcgactttgtccacgttgaggaggcggattacgacggacgcttcctgcgctgcgtcgag
ctggtgaaagagatgatgggcgagcagggtgtttaa

DBGET integrated database retrieval system