KEGG   Citrobacter rodentium: ROD_p2431Help
Entry
ROD_p2431         CDS       T01145                                 

Gene name
triG
Definition
(GenBank) putative conjugal transfer protein TriG
  KO
K03203  type IV secretion system protein VirB8
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2431 (triG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2431 (triG)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2431 (triG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: CBG91864
UniProt: D2TVA8
Position
pCROD2:complement(28403..29089)
Genome map
AA seq 228 aa AA seqDB search
MSEKIEKKIETAKSFERQLYAENERSKKNAWRVAVAASLLSLCLGAAICVLVPLKEKELA
IVAVGEKTGRTELITQVKQEKILQSEALGRYFVNTYITLREGYNYPSLQYDYETVQLYSS
NTVKDDYLRLYNSDMAPDKIYHNNGSYVAVEVISNIISDATAPDKLASVRFKKTTRNFTT
GQVSVSYWTARVTYRFEPEKSVKSSSRELNPLGFTVTSYQTDREVRGE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaatcgaaaagaagattgagacagctaaatccttcgaaagacaactctat
gcagaaaatgaacggtctaagaaaaatgcatggcgtgttgcagtggcagcatcattactg
tccttatgtcttggggctgcaatttgtgttcttgtgccattaaaagaaaaagagcttgct
attgtggctgttggcgaaaaaacaggccgtacagaactgattactcaggttaaacaggaa
aagatcctgcaatctgaagcgcttgggcggtattttgtaaacacgtatattactttacgt
gaaggttataattatccgtctcttcagtatgattatgagactgtacagctatatagctcg
aatacagtaaaggacgattatcttcgtctgtataacagcgatatggctcctgataaaatt
tatcataataacggttcttacgttgcggttgaggtcatctccaatattatttctgacgca
accgcgccagataaactggcctctgtgcgttttaaaaaaacgacgagaaacttcacgacc
ggacaggtttcagtttcatactggacggctcgtgtgacatatcgttttgaaccagaaaag
tcggttaaaagttccagtcgtgagcttaatcctctcggttttacggtaaccagttaccag
acagatcgggaagtcaggggggaatga

DBGET integrated database retrieval system