KEGG   Candidatus Carsonella ruddii PV: CRP_080
Entry
CRP_080           CDS       T00403                                 

Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
crp  Candidatus Carsonella ruddii PV
Pathway
crp00290  Valine, leucine and isoleucine biosynthesis
crp00660  C5-Branched dibasic acid metabolism
crp01100  Metabolic pathways
crp01110  Biosynthesis of secondary metabolites
crp01210  2-Oxocarboxylic acid metabolism
crp01230  Biosynthesis of amino acids
Module
crp_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    CRP_080
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CRP_080
Enzymes [BR:crp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     CRP_080
    4.2.1.35  (R)-2-methylmalate dehydratase
     CRP_080
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-ProteinID: BAF35111
UniProt: Q05FR0
Position
75502..76872
AA seq 456 aa
MNKTIYDKIFESHVIKKYNNLYILYIDKILLHEVTSPQAFMSIGKKILWNKSSIFSTSDH
NVSTNFKHRFFYNKNLKQLKCLKKNFKKFFFKYYDINSPKQGIIHIIASESKILLPGMIA
ICGDSHTTTNGALSLIANGIGTTDIEIGISTQCIIQKKLKNMKIVINNFLNKNVTSKDLI
LFIIKKITSKGGTGYSIEFKGDCIKSLSISEKMTLCNMSIEAGSKISIISPDVKTINFYK
KKIKNIKKFINYLKQIKSNKKSFYDKTFYYNAKNIYPHITWGSNLDTIIELDELVHSDNF
KMLKYMNLKSNNSLYKIKIDKVFIGSCTNSRFEDLLVCSKLLLKLNKKKHKNVIAYVVSG
SENIRLKCEFYGIDKIFKKYDFIWKNSGCSMCLAMNEDKLKPGERCVSTSNRNFVGRQGY
KSITHLSSPIFAVISAIYGEFINFKLYNLITNDFDF
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaataaaaccatctatgataaaatttttgaaagtcatgtaattaaaaaatataataac
ttatatattttatatatagataaaattttattacacgaagttacgtctccgcaagctttt
atgtcaataggaaaaaaaatattgtggaacaaaagtagtattttttctacttcagaccac
aatgtttcaactaattttaaacatagatttttttataataaaaatttaaaacagttaaaa
tgcttaaaaaaaaattttaaaaaatttttttttaaatattatgatattaatagtccaaaa
caaggaataattcatattatagcatctgaatctaaaattttattacctggaatgatagct
atatgtggagattctcatacaacaacaaatggagcattgtcactaatagcaaatggtatt
ggcacaacagacatagaaattggaatatcaactcaatgtattattcaaaaaaaattaaaa
aatatgaaaatagtaattaataactttttgaataaaaatgtaacttcgaaagatttaatt
ttatttataataaaaaaaataacttcaaaaggaggaacaggatattcaattgaatttaaa
ggagattgtattaaatctttatcaatttctgaaaaaatgactttatgcaatatgtctatt
gaagctggttcaaaaataagtataatttctcctgatgttaaaactattaatttttacaaa
aaaaaaataaaaaatataaaaaaatttattaattatttaaaacaaattaaatcaaataaa
aaatctttttatgataaaacattttattataatgcaaaaaatatttatcctcatattact
tggggtagtaatcttgatactatcatagaactagatgaattagttcattctgacaatttt
aaaatgttaaaatatatgaatttaaaaagtaacaattctttatataaaataaaaatcgat
aaagtttttatcggatcatgtacaaattctagatttgaagatttattagtttgttcaaaa
ttattattaaaattaaacaaaaaaaaacacaaaaatgttattgcgtatgtagtatctgga
tcagaaaatataagattaaaatgtgaattttatggtatagataaaatttttaaaaaatat
gattttatatggaaaaattctggatgttcaatgtgtttagcaatgaacgaagataaatta
aaaccaggagaaagatgtgtatcaacatctaatagaaattttgtaggaagacaaggatat
aaaagtattactcatttgtctagtcctatatttgctgttatatctgctatttatggagaa
tttataaattttaaactttataatttaataacaaatgattttgatttctaa

KEGG   Candidatus Carsonella ruddii PV: CRP_081
Entry
CRP_081           CDS       T00403                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
crp  Candidatus Carsonella ruddii PV
Pathway
crp00290  Valine, leucine and isoleucine biosynthesis
crp00660  C5-Branched dibasic acid metabolism
crp01100  Metabolic pathways
crp01110  Biosynthesis of secondary metabolites
crp01210  2-Oxocarboxylic acid metabolism
crp01230  Biosynthesis of amino acids
Module
crp_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    CRP_081
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CRP_081
Enzymes [BR:crp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     CRP_081
    4.2.1.35  (R)-2-methylmalate dehydratase
     CRP_081
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-ProteinID: BAF35112
UniProt: Q05FQ9
Position
76856..77422
AA seq 188 aa
MILISKFLILNINNIDTDLIIPKQFLKTIKKTGFYYCLFYDLRYLINQNNIFLNYDFPFN
IKKNKNAKILISRKNFGCGSSREHAVWAIKDFGIKIIIAESFSDIFYDNSFKNNLFLIKL
KNFEINFIINNYEINIIYINIKNQFLKFNNKLFYFNINNLYKNILLSNFSIIDFLLEKKD
IIFLFYKR
NT seq 567 nt   +upstreamnt  +downstreamnt
atgattttgatttctaaatttttaatactaaatattaataatattgatactgatttaatt
attccaaaacaatttttgaaaacaataaaaaaaacaggtttttattattgtttattttat
gatttaagatatttaataaatcaaaataatatttttttaaattatgattttccatttaat
attaaaaaaaataaaaatgctaaaatattaatttctagaaaaaattttggatgtggaagt
tctagagaacatgctgtttgggcaataaaagattttggaattaaaataattattgctgaa
agttttagtgatattttttatgataattcttttaaaaataatttatttttaataaaatta
aaaaattttgaaattaattttataattaacaattatgaaataaatataatttatattaat
ataaaaaatcaatttttaaaatttaataataaattattttattttaatataaataattta
tataaaaacatattattaagcaatttttcaataatagactttttattagaaaaaaaagat
ataatatttttgttttataaaagatga

DBGET integrated database retrieval system