KEGG   Candidatus Carsonella ruddii PV: CRP_082
Entry
CRP_082           CDS       T00403                                 

Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
crp  Candidatus Carsonella ruddii PV
Pathway
crp00290  Valine, leucine and isoleucine biosynthesis
crp00660  C5-Branched dibasic acid metabolism
crp01100  Metabolic pathways
crp01110  Biosynthesis of secondary metabolites
crp01210  2-Oxocarboxylic acid metabolism
crp01230  Biosynthesis of amino acids
Module
crp_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    CRP_082
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CRP_082
Enzymes [BR:crp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     CRP_082
SSDB
Motif
Pfam: Iso_dh DUF166
Other DBs
NCBI-ProteinID: BAF35113
UniProt: Q05FQ8
Position
77419..78468
AA seq 349 aa
MINLLILPGDGIGPEIIKQVIKIVKSCIYTGYKINIIYNYIGGISIDKFNTPITNNLISI
IKYIDTIFLGCVGGYKWNHSIFKPEYGLLKLRKKFNFFTNIRPIKCPFKNIDIIIVRELN
GGIYYGKPKGFSKQIINQIPTWYAYNTKIYNEQEIIRLARISFNLALNRKKKLCSIDKSN
VLETFKLWKKTINYVHKFYNKVKLSHIYIDYATIDLIKNFNKFDVIITSNLFGDIISDLC
SLLTGSLGMLPSISINNKSLSLFEPCHGSAPDIANKNIANPVGALLSLVMMFEYVLNDFK
LSNNLYYSIYKVLSYGFCTIDMKKYIRNFKIVSTEEFGDLVNHFFIINV
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgattaatttattaattttaccaggagatggtataggaccagaaataattaaacaagta
attaaaatagttaaatcatgtatttatactggttataaaataaatataatttacaattat
attggtggtatttcaatcgataaatttaatactcctattacaaataatttaataagtatt
ataaaatatatagatacaatttttttaggatgtgtaggaggatataaatggaatcattct
atatttaaaccagaatatggtttattaaagttaagaaaaaaatttaatttttttactaat
ataagaccaataaagtgtccttttaaaaatatagatataataattgtaagagaattaaac
ggtggtatttattatggtaaacctaaaggtttttctaaacaaattataaatcaaatacca
acatggtatgcttataatactaaaatatataatgaacaagaaataataagattagctaga
attagttttaatttagctttaaatagaaaaaaaaaactgtgttcaattgataaatcaaat
gtattagaaacatttaaactatggaaaaaaacaataaattatgttcataaattttataat
aaagtaaaactttctcatatttatattgattatgcaacaattgatttaataaaaaatttt
aacaaatttgatgtaattataacttcaaatttatttggagatataatatctgatttatgc
tcgttattaacgggatcattaggtatgttaccatcaatttcaataaataataaatcacta
agtttgtttgaaccatgtcatggtagtgctccggatattgctaacaaaaatattgcaaat
cctgtaggcgctttactatcattagtaatgatgtttgaatatgttttaaatgattttaaa
ttatctaataatttatattattctatttacaaagttttgtcatatggtttttgcacaatt
gatatgaaaaaatatattagaaattttaaaatagtaagtaccgaagaatttggtgattta
gtaaatcatttttttataataaatgtttaa

DBGET integrated database retrieval system