KEGG   Candidatus Carsonella ruddii PV: CRP_127
Entry
CRP_127           CDS       T00403                                 

Definition
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
crp  Candidatus Carsonella ruddii PV
Pathway
crp00290  Valine, leucine and isoleucine biosynthesis
crp00660  C5-Branched dibasic acid metabolism
crp00770  Pantothenate and CoA biosynthesis
crp01100  Metabolic pathways
crp01110  Biosynthesis of secondary metabolites
crp01210  2-Oxocarboxylic acid metabolism
crp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CRP_127
   00660 C5-Branched dibasic acid metabolism
    CRP_127
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CRP_127
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CRP_127
Enzymes [BR:crp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     CRP_127
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M CO_dh
Other DBs
NCBI-ProteinID: BAF35158
UniProt: Q05FL3
Position
complement(118045..119709)
AA seq 554 aa
MKFSSSKIIINSLINENVEFIFGYPGGAVLNIYDEIFKSGIKHILVRHEQSAIHMADGYS
RSSNKIGVVIVTSGPGYTNCVTGIATASIDYSSIIILCGQVNKILIAQNSFQELNNLSIS
LPIVKQFYSLNCYYNIPYLIKESFSNSLNFINGPIIINFPKDLTYFKNTSRYKYPFFLKK
KKNIKEKTFNINNYKRPIIIIGGGFFKNYKNKNIENLILNTKIPIVSTIMGIGKINYRKL
NYLGWIGMHGNSVSNIILNFADLIICLGSRLDDRITNNPRLFAPYAKILHFDINDNSISK
TIFCNFFFKNINFIKEFSLKLNKKWWKIILFYKKFFLNNYKNNFKICLPQQIIELVYFVS
KGKYFISTDVGQHQMFAAKYYYYNYKRFLTSSGLGTMGFGLPSSIGIKFANKNNSILLIT
SESSFQMMMQELSTCKQYSINIKILNLNNQSLGMVKQWQELNYYKRYSSSYMNSIPNFKK
LMFSYLFHCFNFFNIKLFYYFFISIFKKDIFCFINIYININENVLPIQINNKSVNEFIAF
FSKIKYENKINLFI
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaagttttcatcttcaaaaataataattaattctttaataaacgaaaatgtagaattt
atttttggttatcctggtggagctgtattaaatatttacgatgaaatttttaaatctgga
attaaacatatattagtaagacacgaacaatcagcgattcatatggcagatggatattct
agatcatcaaataaaattggagtagttattgttacctctggcccaggatatactaattgt
gtaactggtatagcaactgctagtattgattattcttcaataataatattatgtggtcag
gttaataaaattttaatagcacaaaattcttttcaagaattaaataatttaagtatatcg
ttacctattgttaaacaattttattctttaaattgctattataatattccatatttaata
aaagaatctttttctaattctttaaattttataaatggaccaataattattaattttcca
aaagatttaacgtattttaaaaatacatctagatataaatatcctttttttttaaaaaaa
aaaaaaaatataaaagaaaaaacatttaatataaataattataaaagaccaataataata
attggaggtggtttttttaaaaattataaaaataaaaatatagaaaatttaattttaaat
acaaaaattccaattgtaagtacaataatgggaattggcaaaataaactatagaaaatta
aattatttaggttggatcggaatgcatggaaattctgtttcaaatattattttaaatttt
gcagatttaattatttgtttaggatcaagattagacgatagaattacaaataatccaaga
ttatttgcgccttatgctaaaattttacattttgatataaatgataattctatatctaaa
acaatattttgtaattttttttttaaaaatattaattttattaaagaatttagtttaaaa
ttaaataaaaaatggtggaaaataattttattctataaaaaattttttttaaataattat
aaaaataattttaaaatttgtttacctcaacaaataattgaactagtatattttgttagc
aaaggaaaatactttatttctacagatgttggacaacatcaaatgtttgctgcaaaatac
tattattataattataaaagatttttaacttcaagtggattaggaactatggggtttggt
ttaccttcaagtattggaataaaatttgcaaacaaaaataatagtattttattaattaca
agcgaaagtagttttcaaatgatgatgcaagaattatctacttgtaaacaatatagcata
aacattaaaatattaaatttaaataatcaaagtttaggaatggtaaaacaatggcaagaa
ctaaattattataaaaggtattcaagttcatatatgaattctattcctaattttaaaaaa
ttaatgttttcttatttgtttcattgttttaatttttttaatattaaactattttattat
ttttttataagcatatttaaaaaagatatattttgttttattaatatatacataaatata
aatgaaaatgttttgccaatacaaattaataataaatcagtaaatgaatttattgctttt
ttttcaaaaataaaatatgaaaataaaattaatttatttatttaa

DBGET integrated database retrieval system