KEGG   Crassaminicella sp. SY095: FQB35_06705
Entry
FQB35_06705       CDS       T06186                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
crs  Crassaminicella sp. SY095
Pathway
crs00472  D-Arginine and D-ornithine metabolism
crs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    FQB35_06705
Enzymes [BR:crs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     FQB35_06705
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: QEK12089
UniProt: A0A5C0SGK8
Position
1405217..1407433
AA seq 738 aa
MKKLDINKKLDVREILDDLENYRPKRRGWTWREKIDNLQIGPHTYNDCSKPLKNSIGIPA
AVQYFDNLDPQPKETITTEIASGRFEDDIRRMRMAAWHGADHMMVIRTAGQSHFDGLIEG
TPQGIGGIPVTRKQIRAQRKAIDLIEEEVGRPINYHSYVSGVAGPEVAVMFAEEGVNGAH
QDPQYNVLYRNINMIRSFVDAAESKKVMAWADIAQIDGAHNANATARDAWKVMPELIVQH
AINAIFSYKAGMKKENICLSTVPPSASPVPCMKYDLPYAVALRDFLSEYKMRAQQNTKYI
TSSSREATVTHVMNMMISKLTRADIQSTITPDEGRNVPWHMYNIEACDTAKQTLVGLDGL
MDMVEIKKDGYLPKKVRELKERAVLFLEELIEVGGYFEAVEKGFFVDSGMYPERNGDGIG
RKINGGIGAGTVFERDEDYMAPVTAHFGYNNVAQYDPDAIDNPSSLIGGCTFEKPEKIVY
IDELDENDNVYIRLDETEKYRNSNLIKPEVEWLADGTVQVELFLPTSKRIAEFAALEFAK
KMNLSDPEVIHSEVMHPSEGTRIQLKGKLDFDVDITKLDIPPEAEVLSDEELWAEIERKP
MKVVAATVGEDEHSVGLREVIDIKHGGIEKWGIEVEYLGTSCPVEKLVDAAIELNADAIL
ASTIISHDDIHYKNMKRIHELCVEKGIRDKIIIACGGTQVTPEIAVKQGVDAGFGRGSKG
IHVATFLVKKRKEMNNES
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgaaaaaattggatatcaataaaaaattagacgttagagagattttagatgatttagag
aactatagaccaaagagaagaggatggacttggagagaaaagatagataatcttcaaatt
ggaccacatacatataatgattgttcaaaacctttaaagaattctattggaattcctgct
gctgtacaatactttgataatttagatccccagccaaaggagactattactacagaaatt
gcttcaggtagatttgaagatgatattagaagaatgagaatggctgcatggcatggtgca
gatcatatgatggtaattagaactgctggtcaatctcactttgatggtcttatagaagga
acaccacaggggatagggggtattcctgttacaagaaaacaaattagggcacaaagaaaa
gctatagatttaatagaagaagaggtaggaagaccaataaattatcattcatatgttagt
ggtgttgcaggacctgaagtagcagttatgtttgcagaagaaggagtaaatggtgctcat
caagaccctcaatataatgttctttatagaaatattaacatgattagatcttttgtagat
gcagcagaatctaaaaaagtaatggcatgggcagatatagctcaaattgatggtgcgcat
aatgctaatgcaactgcaagggatgcttggaaagtcatgcctgaattaattgtccaacat
gcaataaatgcgattttttcttataaagctggtatgaagaaagaaaatatctgtctttca
acagtgccaccttcagcttctcctgtaccttgtatgaaatatgatcttccatatgctgta
gcattaagagattttttatctgaatataagatgagagcacaacaaaacacaaaatatata
acttcttcatcaagggaagctactgtgactcatgttatgaatatgatgatttctaagctt
acaagggctgatattcagtcaacaattacacctgatgaaggaagaaatgttccatggcat
atgtataatatagaagcttgtgatacagcaaagcaaacacttgtaggattagatggttta
atggatatggtagaaattaagaaggatggatatttacctaaaaaagttagagaattaaaa
gaaagagcagtattgtttttagaagaacttattgaagttggtggatattttgaagcagta
gaaaaagggttttttgttgattcaggtatgtatccagaaagaaatggtgatggcatagga
agaaaaattaatggtgggataggtgcaggaacagtttttgaaagagatgaagactatatg
gcacctgtaacagctcattttggttataataatgttgcccagtatgatcctgatgcgata
gataatccatcaagcttaataggtggttgtacttttgaaaaaccagaaaaaatagtttat
attgatgaattagatgaaaatgataatgtatatattcggttagatgaaactgaaaagtat
agaaattctaatcttattaaaccagaagtagaatggctagctgatggaactgttcaagtt
gagctatttctcccaacaagtaagagaattgcagaatttgctgcattagaatttgctaag
aaaatgaatctttcagaccctgaggttatacattctgaggttatgcatccatcggaggga
acaagaatacaattaaaagggaaacttgattttgatgttgatattactaaattagatatt
cctccagaagctgaagtgcttagtgatgaagaactgtgggctgagattgaaagaaaacct
atgaaggttgtagctgcaactgttggagaagatgaacactctgttggacttcgtgaagtt
attgatattaaacatggaggtatagaaaaatggggtatagaagttgagtaccttggaact
tcctgtcctgtagaaaaacttgtagatgcagctatcgaacttaatgctgatgcgatttta
gcatctacaattattagtcatgatgatattcactataaaaatatgaaaagaattcatgaa
ttgtgtgtagaaaaaggaataagggataagattataattgcttgtgggggtacacaagtt
acacctgaaatagctgtaaagcaaggagtagatgctggatttggcagaggatctaaagga
attcatgtggctacatttcttgttaaaaaaagaaaggaaatgaacaatgaaagttga

DBGET integrated database retrieval system