KEGG   Candidatus Carsonella ruddii HT (Heteropsylla texana): A355_0123Help
Entry
A355_0123         CDS       T02196                                 

Definition
(GenBank) hypothetical protein
Organism
crt  Candidatus Carsonella ruddii HT (Heteropsylla texana)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_9 Fer4_10 Fer4_7 Fer4_17 Fer4_8 Fer4_16 Fer4_18 Fer4_2 Fer4_6 Fer4_21 DUF2838 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFP84151
UniProt: J3VQC1
Position
94347..94529
Genome map
AA seq 60 aa AA seqDB search
MKIKNFLIYNHKNIVKNCINCNYCIIFCPKNKIYKKKKKIFFKCNFCKYCNINCKNNCIN
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaattttttaatttataatcataaaaatattgttaaaaattgtataaat
tgtaattattgtattattttttgtccaaaaaataaaatttataaaaaaaaaaaaaaaatt
ttttttaaatgtaatttttgtaaatattgcaatataaattgtaaaaacaattgcattaat
taa

DBGET integrated database retrieval system