KEGG   Candidatus Carsonella ruddii HT (Heteropsylla texana): A355_0179Help
Entry
A355_0179         CDS       T02196                                 

Gene name
rplV
Definition
(GenBank) putative ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
crt  Candidatus Carsonella ruddii HT (Heteropsylla texana)
Pathway
crt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:crt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A355_0179 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:crt03011]
    A355_0179 (rplV)
Ribosome [BR:crt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A355_0179 (rplV)
  Bacteria
    A355_0179 (rplV)
  Archaea
    A355_0179 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Flavodoxin_3 DUF600
Motif
Other DBs
NCBI-ProteinID: AFP84198
UniProt: J3YQG6
Position
complement(130426..130734)
Genome map
AA seq 102 aa AA seqDB search
MQNNFIFKNIPISYRKMYLYSKILSNKPILYFYKLYFSKKINFYLLKICNTIINICNSTN
IFIKNFFIGKGKIIKKINFRAKGRINFIVKKFCNVKINILYG
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataattttatatttaaaaatataccaatttcttatagaaaaatgtatttatat
tcaaaaattttatctaataaaccaatattgtatttttacaaattatattttagtaaaaaa
ataaatttttatttattaaaaatttgtaatacaataattaatatttgtaattctacaaat
atttttataaaaaatttttttattggaaaaggaaaaattattaaaaaaattaattttaga
gcaaaaggaagaataaattttattgtaaaaaaattttgtaatgtaaaaattaatatttta
tatgggtaa

DBGET integrated database retrieval system