KEGG   Candidatus Carsonella ruddii PC (Pachypsylla celtidis): A357_0119Help
Entry
A357_0119         CDS       T02198                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
crv  Candidatus Carsonella ruddii PC (Pachypsylla celtidis)
Pathway
crv00020  Citrate cycle (TCA cycle)
crv00660  C5-Branched dibasic acid metabolism
crv01100  Metabolic pathways
crv01110  Biosynthesis of secondary metabolites
crv01120  Microbial metabolism in diverse environments
crv01130  Biosynthesis of antibiotics
crv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A357_0119 (sucC)
   00640 Propanoate metabolism
    A357_0119 (sucC)
   00660 C5-Branched dibasic acid metabolism
    A357_0119 (sucC)
Enzymes [BR:crv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A357_0119 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: AFP84328
UniProt: J3YQR7
Position
complement(91631..92668)
Genome map
AA seq 345 aa AA seqDB search
MNLYEYESKKILLKYNLPVLNSYLTNKFLFIKNYIYKIQVDSNYRKKGGGIIIPHTKNEL
IIFYNKWIFKKFNKKLIKNFLLEKIIKIEIELFLSLYIQNDNLIIVISNKGGINVEFENK
NYFLKIKIKTFILFYSIYDYLLNCKVFKKTILNIIILIFKLYKVIIKNNILLMEINPLVI
YKKNIFILDCKIIKEGIKTRNFSDFISNILKLNYIKLKGNICCIVNGAGLALKILDIFSF
NNLKCSNFIDLSGSITEIFINNLLKMILIDKNLSFLIINIFGGIVSCEKILIGFLNIFYY
NFNFKIIIKLNGLNSKFVLKKLINLKNVIIINNYKYLFYKCKILK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatatgaatatgaatcaaaaaaaattttattaaaatataatttacctgtttta
aattcttatttaacaaataaatttttatttattaaaaattatatttataaaatacaagtt
gattcaaattatagaaaaaaaggaggaggaattataattccacatacaaaaaatgaatta
ataatattttataataaatggatttttaaaaaatttaataaaaaattaattaaaaatttt
ttattagaaaagattataaaaattgaaattgaattgtttttatcattatatatacaaaac
gataatttaattatagttattagtaataaaggtggaataaatgttgaatttgaaaataaa
aattattttttaaaaattaaaataaaaacttttatattattttattcaatatatgattat
ttgttaaactgtaaagtttttaaaaaaactattttaaatataataattttaatttttaaa
ttgtataaagttataattaaaaataatattttattgatggaaataaatccattagttatt
tataaaaaaaatatttttattttagattgtaaaataataaaagaaggaataaaaacaaga
aatttttctgattttatatcgaatattttaaaattaaattatataaaattaaaaggaaac
atatgttgtattgtaaacggtgcaggattagcacttaaaatattagatattttttctttt
aataatttaaaatgttcaaactttatcgatttaagtggttcaataacagaaatttttata
aacaatttattaaaaatgattttaatagataaaaatttaagttttttaataataaatata
tttggaggaatagtatcgtgtgaaaaaatattaatcggatttttaaatattttttactat
aattttaattttaaaataataataaaattaaatggtttaaattctaaatttgtattaaaa
aaattaattaatttaaaaaacgttataattattaataattataaatatttattttataaa
tgtaaaattttaaaatga

DBGET integrated database retrieval system