KEGG   Candidatus Carsonella ruddii PC (Pachypsylla celtidis): A357_015Help
Entry
A357_015          CDS       T02198                                 

Gene name
metF
Definition
(GenBank) putative 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
crv  Candidatus Carsonella ruddii PC (Pachypsylla celtidis)
Pathway
crv00670  One carbon pool by folate
crv01100  Metabolic pathways
crv01120  Microbial metabolism in diverse environments
crv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A357_015 (metF)
Enzymes [BR:crv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     A357_015 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AFP84242
UniProt: J3TEM4
Position
13052..13771
Genome map
AA seq 239 aa AA seqDB search
MKNISFELFPCNNIKDLSILINYLKNKKPSFISVTFGKIKNLKFVENLQKKFSVKIIPHL
ICDNIFNIINNIIYFIKIKIFTFLIITGDKNKNNSINYISLIRILFGYLIKIITGCYFEN
HKFSDNFKNEILFHYKKNKKGVNINISQFFYNFNIINYYIKVIKKTGINKNLILGIILKK
EIKDILNFVNLCKIDIPLWLIKNYYEFNIELFFIKNLKKYKNLHFYTFNNISLVKNYFK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattagttttgaattatttccttgtaataatattaaagatttatctatatta
ataaattatttaaaaaataaaaaaccgagttttatatctgtaacatttggaaaaattaaa
aatttaaaatttgtagaaaatttacaaaaaaaattttctgtaaaaataataccgcattta
atttgtgataatatatttaatattattaataacattatttattttataaaaattaaaatt
tttacttttttaattattactggtgataaaaataaaaataattctattaattatattagt
ttaattagaattttatttggttatttaattaaaataataacgggatgttattttgaaaat
cacaaattttccgataactttaaaaatgaaattttatttcattataaaaaaaataaaaaa
ggagtaaatataaatatttcacaatttttttacaattttaatattattaattactatatt
aaagttattaaaaaaacaggaataaacaaaaatttaatactaggcataattttaaaaaaa
gaaataaaagatattttgaattttgttaatttatgtaaaatagatattccattgtggtta
ataaaaaattattatgaatttaatattgaacttttttttattaaaaacttaaaaaaatat
aaaaatttacatttttacacttttaataatattagtctagttaaaaattactttaaataa

DBGET integrated database retrieval system