KEGG   Candidatus Carsonella ruddii PC (Pachypsylla celtidis): A357_094Help
Entry
A357_094          CDS       T02198                                 

Gene name
putA
Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
crv  Candidatus Carsonella ruddii PC (Pachypsylla celtidis)
Pathway
crv00250  Alanine, aspartate and glutamate metabolism
crv00330  Arginine and proline metabolism
crv01100  Metabolic pathways
crv01110  Biosynthesis of secondary metabolites
crv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:crv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A357_094 (putA)
   00330 Arginine and proline metabolism
    A357_094 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:crv03000]
    A357_094 (putA)
Enzymes [BR:crv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A357_094 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     A357_094 (putA)
Transcription factors [BR:crv03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    A357_094 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg LuxC
Motif
Other DBs
NCBI-ProteinID: AFP84304
UniProt: J3Z217
Position
complement(70404..73448)
Genome map
AA seq 1014 aa AA seqDB search
MNNFQLLNIISKYYLIEDNIYLLELLKNCYFKNDFFKKVKEISLNLTNEARKNLYLDNLD
NLLGEYNLSTKEGIQLMCLAESLLRIPDFYSADSFIKDKISFQDWSYYYSSDYWKIIFYN
MIIDFCSIAYYKFYSENKNMFIKIFKKTVVFFSNYVMKHIGKKFVYSSDIVKAVQKSISD
KNIYSFDMLGEAALTYYDARKFFNQYKLAINEIRKCYTEHNFNERLPSISIKLSALNPKY
SFFNIEQIMRDMIPLIKILIYNAKEAFVSITIDAEEVDRLELSLILFNNIFYSKLCKNWG
KFGIVVQAYSKRAIPILYWLNYISIEQNKTIPVRLVKGAYWDYEIKYSQTLNLPMYPVYI
NKFCTDLSYLLCSIYMLSNLCKTHIYPQFATHNIQTISFILTLSNDKNYEFQKLYGMGDD
VYRSLKKIYNITYREYAPIGKYKELLPYLVRRLLENGANSSFVNKVIDKNISLHILNKNP
FKINNKKYNSKIPLPVDLFGGTRNSIFFYNLNISFHNYNFYKKINLFYNKKWIATSYVNN
SKKKTISYSPFNNYSVIGILKHDFNINNSIKILKKSFFLWKSISIFKKVKIIKNFILLLK
HNFIELILMCCKEAGKTIIDSISDIKEAIDFCYYYCNQAILLNKKVFLPCTTGENNIYML
EGKGIFSAISPWNFPVAIFCGQLISALLSGNVVLVKPAESTSLIAFKILKLLFKSGIPIS
VCQLIIGKGSTIGNEISYHKDICGIIFTGSNEVANIISKNLIMRQNTPLYKLIAETGGIN
TLLVDSTALIEQVVYDIVESAFKSCGQRCSALRLVYINENIYFDTLKLLMSVLLNINVGN
PLNLSYDIGPIITKKNFLSLNKYINTYKKKNVYFKEEKHFLGNFINPTLIRVNSINDLKS
EQFGPILHISIFKNNQIDQIISDINHSNFGLTLGIHSRNEAFYKYLSNNLKIGNIYINRN
TIGAIVGMQPFGGCNLSGTGPKAGGCNYLLSLINEKTITINTTAQGGNTILLNE
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgaataattttcaactattaaatataataagtaagtactacttaatagaagataatata
tatcttttagaattattaaaaaattgctattttaaaaatgatttttttaaaaaagtaaaa
gaaatatctttaaatttaacaaatgaagcaagaaaaaatttatatttagataatttagat
aatttattaggagaatataatttaagtacaaaagaaggaatacaattaatgtgtttagca
gaatctttacttagaatacctgatttttattcagctgattcttttattaaagataaaatt
tcttttcaagattggtcttattattattcttcagattattggaaaattatattttataac
atgattatcgatttttgttcaattgcatattataaattttattcagaaaataaaaatatg
tttattaaaatttttaaaaaaacagttgtttttttttcaaactatgttatgaaacatatt
ggtaaaaaatttgtttattctagtgatattgttaaagctgtacaaaaatcaataagtgat
aaaaatatttattcttttgatatgctaggtgaagcagcacttacatattatgatgccaga
aaattttttaaccaatataaattagcaattaatgaaattagaaaatgttatactgagcat
aattttaatgaaagattaccatcaatttcaataaaattatcagcgttaaatcctaaatat
tcattttttaatattgaacaaattatgagagatatgattcctttaattaaaatattaatt
tataatgcaaaagaagcatttgtatcaattactattgatgcagaagaagttgatcgttta
gaattatctttaattctttttaataacattttttattcaaaattatgtaaaaattgggga
aaatttggtattgtagttcaagcatattcaaaaagagcaattccaattttatattggtta
aattatatttctatagaacaaaataaaacaatacctgtaagattagttaaaggagcatat
tgggattatgaaattaaatattctcaaactttaaatttaccaatgtatcctgtttatatt
aataaattttgtactgatttatcatatttattatgttcaatatatatgttatcaaattta
tgtaaaacacatatttatcctcaatttgcaactcacaatattcaaacaatatctttcatt
ttaacattatcaaatgacaaaaattatgaatttcaaaaattatatggaatgggagatgat
gtttatcgttcgttaaaaaaaatatataatattacatatagagaatatgctccgattggt
aaatataaagagttgcttccttatttagtaagaagattattagaaaatggtgctaattct
tcttttgttaataaagttattgataaaaatattagtttacatattttaaataaaaatcct
tttaaaatcaataataaaaaatataatagtaaaataccattaccagtagatttatttggt
ggaactcgaaattcaatatttttttataatttaaatatttcatttcacaactataatttt
tataaaaaaattaatttattttataacaaaaaatggattgcaacttcgtacgtaaataat
tctaaaaaaaaaaccatttcatattctccttttaataattattctgtaattggaatatta
aaacatgattttaatattaataattctattaaaatattaaaaaaatcattttttttatgg
aaaagtattagtatttttaaaaaagtaaaaataattaaaaattttattttgttattaaaa
cataattttatagaattaatattaatgtgttgcaaagaagcaggaaaaacaattattgat
tctatttcagatattaaagaagcaatagatttttgttattattattgtaatcaagcaatt
ttattaaataaaaaagtttttttaccttgtacaacaggagaaaataatatttatatgtta
gaaggaaaaggaattttttcagcaattagtccttggaattttccagtagctattttttgt
ggacaattaatttcagcattattatcaggaaatgttgttttagttaaacctgcagaaagt
acatcattaattgcatttaaaatattaaaattattatttaaatcaggtattccaataagt
gtatgtcaattaataattggtaaaggatctactattggaaatgaaatttcataccataaa
gatatatgtggaattatttttacaggttcaaatgaagttgcaaatattattagtaaaaat
ttaataatgagacaaaacactccgttgtataaattaattgctgaaactggaggaataaat
actttattagttgattcaacagcattaatagaacaagtagtatatgatatagttgaatct
gcttttaaaagttgcggacaaagatgttcagcattaagattagtatatataaatgaaaat
atttattttgatacattaaaattattaatgagtgttttattaaatataaatgttggaaat
cctttaaatttatcttatgatattggaccaataataacaaaaaaaaattttttaagttta
aataagtatattaatacttataaaaaaaaaaacgtttattttaaagaagaaaaacatttt
ttaggtaattttataaacccaacattaattagagttaatagtattaatgatttaaaaagt
gaacaatttggtcctatattacatatatcaatatttaaaaataatcaaatagatcaaata
atttctgatattaatcattctaattttggattaacactaggaattcatagtagaaatgaa
gcgttttataaatatttatcaaataatttaaaaataggaaatatttatattaatagaaat
acaataggtgcgattgttggaatgcaaccatttggtggatgtaatttatcaggtactgga
ccaaaagctggaggttgcaattatttactttcattaataaatgaaaaaacaataactata
aatacaactgcacaaggaggaaacacaattttattaaatgaataa

DBGET integrated database retrieval system