KEGG   Cryobacterium sp. LW097: B7495_07700Help
Entry
B7495_07700       CDS       T04908                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cry  Cryobacterium sp. LW097
Pathway
cry00471  D-Glutamine and D-glutamate metabolism
cry00550  Peptidoglycan biosynthesis
cry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cry00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B7495_07700
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B7495_07700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cry01011]
    B7495_07700
Enzymes [BR:cry01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     B7495_07700
Peptidoglycan biosynthesis and degradation proteins [BR:cry01011]
 Precursor biosynthesis
  Amino acid ligase
   B7495_07700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C F420_oxidored Shikimate_DH Oxidored_nitro Pyr_redox_2 AlaDh_PNT_C 2-Hacid_dh_C KR
Motif
Other DBs
NCBI-ProteinID: ASD21990
UniProt: A0A5E8D900
Position
1672323..1673870
Genome map
AA seq 515 aa AA seqDB search
MSAHSFDDPATDPDRLSALTSWHSDWSGLRVAVLGLGMTGFAAADTLAELGAQVLVVAGR
APDERARLLEVLGVPLVTADLDAAPPALVQHNPELVIVSPGFHPDHPLLLWAAEQGIPVW
GDIELAWRLRDKVGPAAPWILVTGTNGKTTTVQMTATMLAAGGHRVAPCGNIGVPVLDAI
RDPQGWDVLVVELSSYQLHHLPLTGPGALVPVSSVCLNIADDHIDWHGSASAYRDAKAKV
YSNTTVACVYNKADLATMRMVEDADVSDGARAIGFGLGVPGPSDLGIVDGILCDRAFLED
RFDSAIELTTITDLAAAGLAAPHVVANILASAALARSFDVSPEAIRVALATFSLDAHRIE
VVAIRDGISWVDDSKATNPHAADASLAAFDSVVWLVGGLLKGVDIGDLVAKHAGRLRGAV
VIGVEREEVLAAFRRHAPALRVFEIDSDDTGEVMPSAVVLAASLATAGDVVLLAPAAASM
DQFASYAERGSKFAQAVHDYLGGGSHEDSSSYPGA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcccactccttcgacgacccggccaccgatcccgatcgcctcagcgccctgacc
agctggcactccgactggtccggcctgcgggtagccgtcctcggcctcgggatgaccgga
ttcgccgcggcggacaccctggccgaactcggcgcgcaggttctcgtcgtcgccggccgc
gcccccgacgagcgtgcgcgcctgctcgaggtcctcggcgtccccctggtcaccgccgac
cttgacgccgcgcccccggccctggttcagcacaatcccgagctggtcatcgtgtcgccg
ggattccaccctgaccacccgctgctgctgtgggccgccgaacagggcatcccggtctgg
ggcgacatcgaactggcctggcggctgcgcgacaaggtcggtcccgccgcgccctggatc
ctcgtcaccggtaccaacggcaaaaccacgactgtgcagatgaccgcgacgatgctcgct
gccggcggccacagggtcgccccctgcggcaacatcggcgtgcccgtgctcgacgccatc
cgcgacccccagggctgggacgtgctcgtcgtcgagctgtccagctaccagctgcaccac
ctgccgttgaccggccccggcgccctggtcccggtctccagcgtctgcctcaacatcgcc
gacgaccacatcgattggcacggctccgcgagcgcgtaccgcgatgcgaaggccaaggtc
tactcgaacaccaccgtcgcctgcgtgtacaacaaggccgacctcgccacgatgcggatg
gtcgaagacgccgacgtcagcgacggcgccagggccatcggcttcggcctgggcgtgccg
ggacccagcgacctgggaatcgtcgacgggatcctctgcgaccgggcgttcctcgaggac
cgcttcgacagcgccatcgagctcaccaccatcaccgacctcgccgccgccgggctggcc
gcgccgcacgtggtggccaacatcctggcctccgccgccctcgccaggtccttcgacgtg
tcgccggaggccatccgggtggccctggccaccttcagtctcgacgcgcaccgcatcgag
gtcgtggcgatccgcgacggcatcagctgggtcgacgactccaaggcgaccaatccccac
gcggcggatgcctcgctggcggcgttcgactccgtcgtctggctggtcggcggcctgctg
aagggcgtcgacatcggtgacctggtggccaagcacgccggccggctgcgcggcgccgtc
gtgatcggcgtcgagcgcgaggaagtcctggcggcatttagacgacacgcccccgccctg
cgcgtcttcgagatcgactcggatgacactggggaggtcatgccgtccgcggtcgttctg
gccgcatccctcgccacggccggggacgtggtcctgctggccccggcggccgcatccatg
gaccaattcgccagctacgcggaacgcgggtcgaagttcgcccaggccgtacacgattat
ttgggaggtgggtcgcatgaagactcgtcctcgtacccgggtgcctga

DBGET integrated database retrieval system