KEGG   Chromobacterium rhizoryzae: D1345_00740Help
Entry
D1345_00740       CDS       T05688                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00860  Porphyrin and chlorophyll metabolism
crz01100  Metabolic pathways
Module
crz_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D1345_00740
Enzymes [BR:crz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     D1345_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AXT44815
Position
complement(181817..182419)
Genome map
AA seq 200 aa AA seqDB search
MNPYTLTLLRHGEIDHDGRLIGSSDLPLNATGHIQMAQSWQRICALAPVTAMASSPLQRC
REFAVRHALHGSLTLKVDPRFAEMDFGDWDCMDVQVLAQRYPDWRAKLAAGELTPPGGEP
YEAFRTRVLAGLSEWMTTANGSHRVLVTHGGVITTLLAELLGADFSVAKLMTVQRGGFAQ
LSILEGHPAYLMRLEAPCAD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaacccctacacgctgaccctgctgcgccacggcgaaatcgaccatgacggccgtttg
atcggcagcagcgatttgccgctaaacgctacggggcacatacaaatggcgcaaagttgg
cagcgcatttgcgcgctggcgccggtaacggcgatggccagttcgcccttgcagcgctgc
cgcgagttcgcggtccggcacgccttgcatggctcgctgacgctgaaagtggacccgcgg
ttcgctgaaatggacttcggcgactgggactgcatggacgtacaggttctggcgcaacgc
tatccggactggcgcgccaaactggccgccggcgaactgacgccgcccggcggcgagccc
tacgaagctttccgcactcgggtgctagccggcctgtccgaatggatgacgacggccaac
ggcagccaccgggtgctggtcacccacggcggcgtcatcaccaccttgctggcggaactg
ctgggcgcggatttctcggtagccaagctgatgacggtgcagcgcggcggctttgcccaa
ttgtccatcctggaaggacatccggcctacctgatgcgtctggaagccccgtgcgcggac
tga

DBGET integrated database retrieval system