KEGG   Chromobacterium rhizoryzae: D1345_06160Help
Entry
D1345_06160       CDS       T05688                                 

Definition
(GenBank) cupin domain-containing protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00450  Selenocompound metabolism
crz00970  Aminoacyl-tRNA biosynthesis
crz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D1345_06160
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D1345_06160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crz01007]
    D1345_06160
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:crz03016]
    D1345_06160
Enzymes [BR:crz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     D1345_06160
Amino acid related enzymes [BR:crz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   D1345_06160
Transfer RNA biogenesis [BR:crz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D1345_06160
 Prokaryotic type
   Other AARSs
    D1345_06160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Cupin_2 tRNA-synt_1e AraC_binding tRNA-synt_1 tRNA-synt_1f Ectoine_synth
Motif
Other DBs
NCBI-ProteinID: AXT45787
Position
1366704..1368722
Genome map
AA seq 672 aa AA seqDB search
MHIIDLNEAQLAPAFGIEMASIAGLGDQERVRLAYGVVEPGGESQPHKHDELEAFLILSG
EGVIDTDGRSQPVRAGSLVLFKPFEKHVLRNPGEQPLRFCDFYWRDAAKRDVAAQDNGAA
RLKGRPVFVFSTPPTPNGDLHLGHLSGPYLGADVYVRFLRASGHEAYHLTGSDDYQSYVV
GRARQENSSPQQVASHYSAAIKSTLDLMDIHLDQYTVTTRDSGYAAGLRDFFSRLVRGGA
QLRSDAALFDAETGDYLYEVDVSAKCPSCGSPCGGNICEECGEPNNCVDLDAPRSRLSDA
VPVTGAIRRYMINLSAFKDAVEQHHRLSKVSPRLQQLAERVLARKDYWVPITHPAQWGVP
PAEEVEGSQVIWVWPEMAYGFLYGIAELGGRLGKPWQADRPQPDWKIVHFFGYDNSYYHS
ILYPALYRMAFPDWQCDIDYNENEFYLLEGLKFSTSRRHAVWGKDILSPDSVDAVRYYLA
RTRGEQERTNFTLDDFHACVERTLLGQWQAWLAGLGERLRQDFQQRAPDAGNWTAAHTAY
FDALSNRLASLSTHYGADGFTLNRVVEDLDGLVAGALRFAKSNERIRLNPALRDEYRTAI
ALELATARLLAQAAGPLMPRFAQRLGRALGMERVDVWPESVELSPPGTSLNLAEQRFFTP
LRRADAAEEGRS
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcatagacttgaacgaagcgcagctggcgccggctttcggcatcgagatggcg
tccattgccggcctgggcgaccaggagcgcgtgcgactggcttacggcgttgtcgagccc
ggcggagaaagccagccgcacaagcacgacgaactggaagcctttctgattttgagcggc
gaaggcgtcatcgacaccgacggccgctcccagccggtgcgcgccggcagcctggtgttg
ttcaaaccgtttgaaaaacacgtgttgcgcaatcccggcgagcagccgctgcgcttctgc
gacttttactggcgggacgcggccaaacgcgacgtcgccgcgcaagacaacggcgccgcg
cgtttgaaggggcgtccggtgttcgtgttttccacgccgcccacgcccaacggcgacctg
cacctgggccatctgtccggcccctatctgggcgccgacgtctatgtgcgcttcctgcgc
gcgagcgggcacgaggcctaccacctcaccggcagcgacgattaccagagctatgtggtg
ggccgcgcccgccaggaaaacagcagcccccagcaggtggccagccattactcggcggcg
atcaagtccacgctggacctgatggacatccatctggatcaatacaccgtcaccacccgc
gactccggctacgccgccggcctgcgcgatttcttctcgcgcctggtgcggggcggcgcg
cagctgcgctccgacgcggcactgttcgacgccgaaaccggcgactatctgtacgaggtg
gacgtttccgccaagtgtccaagctgcggctcgccttgcggcggcaatatctgcgaggag
tgcggcgagccgaacaactgcgtggacctggacgcgccgcgctcgcggctctcggacgcg
gttcccgtcaccggcgccatccgccgctacatgatcaatctatccgccttcaaggacgcg
gtggaacagcaccaccgcctgagcaaggtgtcgccgcgcttgcagcaattggctgagcgg
gtgctggcgcgcaaggactattgggtgcccatcactcatccggcgcagtggggcgtgccg
ccggcggaggaggtcgagggcagtcaggtgatctgggtgtggccggaaatggcgtacggc
ttcctgtacggcattgcggaactgggcggccggctgggcaagccctggcaagcggaccgg
ccgcagccggattggaagatcgtccacttcttcggctacgacaacagctattaccactcc
atcctctatccggccttgtaccggatggcctttccggactggcaatgcgacatcgactac
aacgagaacgagttctatctgcttgagggcctgaagttctccaccagccgccggcacgcg
gtatggggcaaggatatcctgagccccgacagcgtggacgcggtgcgttattacctggcg
cgcacgcgcggcgagcaggagcggaccaatttcacgctggacgacttccatgcatgcgtg
gagcggacgctcttgggccagtggcaggcctggttggccggcctgggcgagcgcttgcgg
caggatttccagcagcgtgcgccagacgccggcaactggaccgccgcgcacactgcctat
ttcgatgcgctaagcaaccggctggccagcctgagcacccattacggcgccgatggtttt
acgctcaaccgcgtggtggaagatctggacgggctggtggccggcgcgctgcgtttcgcc
aaatcgaacgagcgcatccgtctgaatccggcgctgcgcgacgagtaccggaccgcgatc
gcgctggagctggccacggcccgcctgctggctcaggccgccggcccgttgatgccgcgc
ttcgcccagcgcttgggccgcgccttgggcatggagcgcgtcgacgtctggccggaaagc
gtggagctgtcgccgccgggcacgtctttgaacttggcggagcagcgtttcttcacgccg
ctgcgccgggcggacgcggcggaggaagggcggtcatga

DBGET integrated database retrieval system