KEGG   Chromobacterium rhizoryzae: D1345_11515Help
Entry
D1345_11515       CDS       T05688                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00360  Phenylalanine metabolism
crz00362  Benzoate degradation
crz00621  Dioxin degradation
crz00622  Xylene degradation
crz01100  Metabolic pathways
crz01120  Microbial metabolism in diverse environments
crz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    D1345_11515 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D1345_11515 (dmpG)
   00622 Xylene degradation
    D1345_11515 (dmpG)
   00621 Dioxin degradation
    D1345_11515 (dmpG)
Enzymes [BR:crz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     D1345_11515 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: AXT46781
Position
complement(2522775..2523794)
Genome map
AA seq 339 aa AA seqDB search
MDKLYISDVTLRDGSHAVRHRYSLAQVRAIAAALDAAGVDSIEVAHGDGLEGSSFNYGFG
AHSDVEWIAAAAESVSKSKIATLLLPGIATVGALRNAYDAGARIVRVATHCTEADIARQH
IGYARELGMDAVGFLMMSHMTTPQRLAEQAKLMESYGANCVYVVDSGGALLMQEVRDRFR
ALREALRPETETGMHAHHNLSLGVANSIVAVEEGCRRVDASLAGQGAGAGNAPLEVFIAV
AERLGWNHGCDLIRLMDAADDLVRPTQDRPVRVDRETLALGYAGVYSSFLRHAETAARQY
GLKTLDILLEVGRRRMVGGQEDMIVDVALDLLKAKGGTA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgtatatttccgacgtgaccctgcgcgacggctcgcacgcggtccgtcac
cgttattcgctggcccaggtgcgcgccatcgccgcggcgctggacgccgccggcgtggat
tccatcgaagtggcgcacggcgacgggctggagggttccagcttcaactacggcttcggc
gcccatagcgacgtggagtggatcgccgcagcggccgaatcggtgagtaagagcaagatc
gccaccttgctgctgcccggcatcgccaccgtcggcgccttgcgcaacgcttacgacgcc
ggcgcgcgcatcgtccgcgtcgccacccactgcaccgaggccgacatcgccagacagcac
atcggctacgcgcgggaactgggcatggacgccgtcggctttctgatgatgtcgcacatg
accacgccgcagcggctggcggagcaggccaagctgatggaaagctacggcgccaactgc
gtctacgtggtggattccggcggcgctctgttgatgcaggaggtgagagaccgcttccgc
gccttgcgcgaggccttgaggccggaaacggaaaccggcatgcacgcccatcacaatctg
tcgctgggcgtggccaacagcattgtggcggtggaagaaggctgtcgccgcgtcgacgcc
tcgctggccggccagggcgccggcgccggcaacgcgccgctggaagtgttcatcgccgtc
gccgagcggctgggctggaaccacggctgcgacctgatccggctgatggacgccgccgac
gacctggtgcgcccaacccaggaccggccggtgcgggtggaccgcgaaacactggcgctg
ggctacgccggcgtctactccagctttctgcgccacgcggaaacggctgcgcggcaatac
ggtttgaaaaccctggacatcctgctggaagtgggacgccgccgcatggtgggcgggcag
gaggacatgatagtcgacgtggcgctggacttgctcaaggccaaaggaggcacggcatga

DBGET integrated database retrieval system