KEGG   Chromobacterium rhizoryzae: D1345_16310Help
Entry
D1345_16310       CDS       T05688                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00903  Limonene and pinene degradation
crz00930  Caprolactam degradation
crz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D1345_16310
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    D1345_16310
Enzymes [BR:crz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     D1345_16310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Abhydrolase_2 DUF3089 AXE1
Motif
Other DBs
NCBI-ProteinID: AXT49174
Position
complement(3584465..3585292)
Genome map
AA seq 275 aa AA seqDB search
MRERSAKWARGEAKPPRGWRVRKLDAQALRGEWIEPEAAERREATGRVILYLHGGGYCFC
SPVTHRGVAAALAREADARAFSLDYRLAPEHPFPAAVDDALAAYQALLDEGVAADRIVIA
GDSSGGGLALALLLSLRDAGAPLPAGAVLFSPWTDLAATGASLEANDASDVMLSAVAVRN
FSRYYLGDAAADHPIASPLYGDYAGLPDLFIQASDTEVLLDDAARVARKASAARVPVDFK
VWRRLPHAWATLAPMLPEARAAIKEAGGFVRKVAP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagcgcagcgcgaaatgggctcgcggcgaagcaaagccgccgcgcggatggcgg
gtgcgcaagctggacgcgcaggcgttgcgaggcgagtggatagagccggaggccgccgag
cggcgcgaggcgaccgggcgggtcattctgtatctgcacggcggcggctattgcttctgc
tccccggtcacgcaccggggcgtggccgccgcgctggcgcgggaagccgacgcgcgggcg
ttttcgttggattaccggcttgcgccggaacatccgttccccgccgccgtcgacgacgcg
ctggcggcgtatcaggcgctgctggacgagggcgtggcggcggaccggatcgtgatcgcc
ggcgattcgtcggggggcgggctggcgctcgccttgctgctgtcgctgcgcgacgcgggc
gcgcccttgccggccggggcggtgctgttctcgccgtggacggatttggcggcgaccgga
gcgtctctggaagcgaacgatgcgtctgacgtgatgctgagcgcggttgcggtgaggaat
ttctcgcgttactaccttggcgacgccgcggccgatcatcccatcgcctcgccgctctac
ggcgattacgctggtctgcccgatctgttcatccaggccagcgacaccgaggtgctgctg
gacgacgccgcgcgcgtggcccgcaaggcgagcgcggcccgcgtcccggtggacttcaag
gtgtggcggcggctgccgcacgcatgggccaccttggcgcccatgctgccggaggcgagg
gcggcgattaaagaggccggcggtttcgttcgcaaggtggcgccatga

DBGET integrated database retrieval system