KEGG   Chromobacterium rhizoryzae: D1345_19635Help
Entry
D1345_19635       CDS       T05688                                 

Definition
(GenBank) ATP-binding cassette domain-containing protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:crz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    D1345_19635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:crz02000]
    D1345_19635
Enzymes [BR:crz01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     D1345_19635
Transporters [BR:crz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    D1345_19635
   Histidine transporter
    D1345_19635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_13 AAA_15 AAA_23 RsgA_GTPase PRK G-alpha AAA_16 APS_kinase AAA_33 CobU NACHT AAA_22 AAA_24
Motif
Other DBs
NCBI-ProteinID: AXT48242
Position
complement(4300534..4301301)
Genome map
AA seq 255 aa AA seqDB search
MDKLNIQNIHKSYGSHEVLKGVSLTAKAGDVISIIGSSGSGKSTFLRCINFLEKPNQGSI
SLNGEPIRLATTKNGELTPADQKQLQGMRTKLAMVFQHFNLWAHMTVLENVIEAPVHVLG
ISKEEATQRAVKYLRKVGLDEHAQGKYPAHLSGGQQQRVAIARALAMEPEVMLFDEPTSA
LDPELVGEVLKVMQALAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGCPDEVFGN
TKSERLKAFLSGSLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgaatatccagaacattcacaagagctacggcagtcacgaggtgctcaaa
ggcgtttcgctgacggccaaggccggcgacgtgatcagcatcatcggttcgtcaggctca
ggcaaaagcacctttttgcgttgcatcaacttcctggaaaagccgaatcagggcagcatc
agcctcaatggcgagcccatccgcctggccaccaccaagaacggcgaattgacgccggcg
gaccagaagcagctgcaaggcatgcgcaccaagttggccatggtgtttcagcacttcaat
ctgtgggcgcacatgacggtgctggagaacgtgatcgaagcgccggtgcacgtgttgggg
atttccaaggaggaggccacccagcgcgcggtcaaatacctgcgcaaggtgggcctggac
gagcacgcgcagggaaagtacccggcgcatttgtctggcggccagcaacagcgggtggca
attgcgcgcgcgttggcgatggagccggaagtcatgctgtttgacgagcccacctcggcg
ctggacccggaactggtgggcgaggtgctgaaagtgatgcaggcgctggcggaggaaggc
cgcaccatgatcgtggttacccacgagatgggcttcgcccgcaatgtgtccaaccacgtg
atgttcctgcaccaggggcgggtggaggaggagggctgcccggacgaggtgttcggcaac
accaagagcgagcggctgaaggctttcttgtccggcagcctgaagtga

DBGET integrated database retrieval system