KEGG   Chromohalobacter salexigens: Csal_0768
Entry
Csal_0768         CDS       T00347                                 
Name
(GenBank) transcriptional regulator, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
csa  Chromohalobacter salexigens
Brite
KEGG Orthology (KO) [BR:csa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csa03000]
    Csal_0768
Transcription factors [BR:csa03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Csal_0768
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4
Other DBs
NCBI-ProteinID: ABE58125
UniProt: Q1QZI3
Position
860062..861060
AA seq 332 aa
MTNIRKVAELAGVSVATVSRALKTPDVVSPGTRDKVLAAVEQADYRPNLTAVQFRSQRTR
NLVVLVPTIANTFFSQVIGGIQEAAQRRGYGILLCNTLGDERTERAYAGLVSTRQADGLI
QLRAYNPFTASDGKARPPMVNACEVLDEAPCPTVKLDNRAAARAVTEHLLALGHRRIGMI
KGPRNSPLTRDRLLGFQDALAVAGLAPDESLVCPGDFTPSSGYRAAGDLLSQADPPTAIF
CENDEMAMGAMRRIKEAGLRIPEDISVAGFDDIAFASFCDPPLTTIAQPAEDFGREAVAL
LLDIIDDRDGATGEHRIMPFELVIRESTGPAA
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaccaatattcgcaaggtggccgagctggccggtgtgtcggtggcgacggtgtcgcgc
gccttgaagacccccgacgtcgtttcgccgggcacgcgtgacaaagtgttggccgccgtc
gagcaggccgactatcgaccgaacctcacggcggtgcagttccggtcgcaacgcacccgt
aacctggtggtgctggtgccgaccatcgccaacaccttcttttcccaggtgattggcggc
atccaggaagcggcgcagcggcgagggtacggcattctgctgtgcaatacactcggcgat
gaacgtaccgagcgggcttacgccggcctggtgtcgacccgtcaggccgatggtctcatc
cagttgcgcgcctataatcccttcacggcctcggacggcaaggcgcgaccgccgatggtc
aatgcctgtgaggtgctcgacgaggcaccgtgccccaccgtcaagctcgacaaccgagcc
gccgcccgggcggtgaccgagcatctgctggcactggggcaccgccgtatcggcatgatc
aaggggccgcgcaacagtcccttgacccgggatcgtctgctgggctttcaggatgccctg
gccgtcgccggcctggcgccggacgaaagcctcgtgtgtcccggtgacttcacgccatcc
tcagggtaccgggcggctggcgatctgctgtcgcaagctgacccacccacggcgatcttc
tgcgaaaatgatgaaatggccatgggtgccatgcggcgcatcaaggaagcggggctgcgg
atacctgaggacatctcggtggcgggattcgacgatatcgccttcgcttccttctgcgat
cctcccctgacgaccatcgcccagcccgccgaggatttcggtcgcgaggccgtggccctg
ttgctcgacatcatcgatgaccgggatggcgcaacgggtgagcatcgcatcatgcccttc
gagctggtgatacgcgagagcaccgggccggccgcttga

DBGET integrated database retrieval system