KEGG   Chromohalobacter salexigens: Csal_0396Help
Entry
Csal_0396         CDS       T00347                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00670  One carbon pool by folate
csa01100  Metabolic pathways
csa01120  Microbial metabolism in diverse environments
csa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Csal_0396
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Csal_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ABE57758
UniProt: Q1R0K0
Position
442287..443135
Genome map
AA seq 282 aa AA seqDB search
MSTREHPLGVSFEFFPPSTEAGREKLKGVRDTLAERRPRFFSVTYGAGGSTQARTFETVQ
TVRQSGIDTAPHLSCIGSDKGELRERLASFREAGIDSLVALRGDLPSGMGGMGELRYANE
LVEFIREETGDHFQIAVAAYPEAHPQAPSYEHDLQNFVRKMQAGADLAITQYFFSADAYF
HFVERARALGVEAPIVPGIMPITNYTKLARFSDACGADIPRWIRKQLEAYGDDSESIQAF
GSEVVTRLCQRLLDGGAPGLHFYTLNQATPALRVLDNLRCDT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcgcgagcatccgctgggcgtcagcttcgaattctttccacccagcaccgag
gcgggacgggaaaagctgaaaggcgtgcgcgacacgctggccgagcggcgtccgcgtttc
ttttcggtgacctacggcgccggtggctcgacgcaggcacgcaccttcgagaccgtgcag
acggtgcgccagagcggcatcgacaccgcgccgcacctgtcctgcatcggcagcgacaag
ggcgagttgcgcgagcgcctggcgagttttcgcgaggcgggcatcgacagcctggtggcg
ctgcgcggcgacttgccttccggcatgggggggatgggcgagctgcgctatgccaacgag
ctggtcgagttcatccgcgaggaaaccggtgaccatttccagatcgcggtcgcggcctat
cccgaagcccacccccaggcccccagctacgagcacgacctgcagaacttcgtgcgcaag
atgcaggccggggccgatctggccatcacccagtatttcttcagcgccgacgcctacttc
cacttcgtcgagcgtgcccgggcactgggcgtcgaggcgccgatcgtgccgggcatcatg
ccgatcaccaattacaccaagctggcgcgcttttccgacgcgtgcggcgcggacattccc
cgctggatccgcaagcagctggaggcctacggcgatgacagcgagagcatccaggcgttc
ggcagcgaggtcgtcacgcgcctctgccagcggttgctcgatggcggtgcgccggggttg
cacttctatacactgaaccaggcgacgccggcgctgcgggtgctcgacaacctgcgctgc
gatacctga

DBGET integrated database retrieval system