KEGG   Chromohalobacter salexigens: Csal_0577Help
Entry
Csal_0577         CDS       T00347                                 

Definition
(GenBank) RNase HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
csa  Chromohalobacter salexigens
Pathway
csa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:csa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Csal_0577
Enzymes [BR:csa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Csal_0577
DNA replication proteins [BR:csa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     Csal_0577
   Elongation factors (archaeal)
     Csal_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-ProteinID: ABE57939
UniProt: Q1R019
Position
639686..640288
Genome map
AA seq 200 aa AA seqDB search
MTDFPPLVIDYHGSRLAGVDEVGRGPLVGAVVAAAVILDPARPIEGLADSKTLSEKRRLA
LADAIREQAAACAVAEASAEEIDALNIFHATHLAMRRAIDALPVTAEYLLVDGNRMPGHH
VPGQCVVKGDRRHAAIGAASILAKVTRDAQMVALHERHPEYGFARHKGYPTREHLAALER
LGPLEEHRRSFAPVKQWQLL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacggattttccgccactggtgatcgactaccacggctcgcgcctggcgggtgtcgac
gaagtcggtcgcggccccctggtgggggccgtggtcgcggccgccgtgatcctcgatccg
gctcgtcccatcgaggggctggccgattccaagaccctcagcgagaaacgccgcctggcc
ctggcggacgccatccgcgagcaggccgcggcgtgcgcggtggccgaggcgtccgccgag
gagatcgatgcgctcaatatctttcatgccacgcacctggccatgcgccgggccatcgat
gccttgcccgtgacggcggaatatctgctggtggacggcaatcggatgccggggcatcat
gtgccggggcagtgcgtggtcaagggcgaccgccgccatgcggcgatcggggccgcctcg
attctcgccaaggtgacgcgcgacgcccagatggtcgcgctgcacgaacgccaccccgag
tatggtttcgcgcgccacaagggctatcctacccgagagcatctcgcggccctcgaacgc
ctggggccgttggaggaacaccgccgctcctttgcgccggtcaagcaatggcagctgctg
tag

DBGET integrated database retrieval system