KEGG   Chromohalobacter salexigens: Csal_0693Help
Entry
Csal_0693         CDS       T00347                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00620  Pyruvate metabolism
csa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Csal_0693
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csa02000]
    Csal_0693
Enzymes [BR:csa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Csal_0693
Transporters [BR:csa02000]
 Other transporters
  Primary active transporters [TC:3]
   Csal_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABE58054
UniProt: Q1QZQ4
Position
775595..777403
Genome map
AA seq 602 aa AA seqDB search
MSDTQRPLGITDVVLRDAHQSLFATRMRLDDMLPIAEKLDRVGFWSLESWGGATFDACIR
YLGEDPWARIRALKEAMPNTPQQMLLRGQNLLGYRHYADDVVDAFVERARANGVDVFRVF
DAMNDTRNLERALKAVVACEGHAQGTLAYTVSPVHTLESWLDMAKRIEDMGAHSLAIKDM
AGLLTPYMAHELVSRLKQTVALPIHVHCHATTGLSTATLLKAVEAGADTVDTAISSMAMT
YGHSPTESLVAMLRETPRDTGLDLELLEDIAAYFREVRKKYTAFEGSLRGIDSRILVAQV
PGGMLTNMEGQLKEQGAGDRLDEVLGEIPRVREDLGYIPLVTPTSQIVGTQAVMNVMMGS
RYQSISKEVQALLKGEYGAAPAPFDADLQARALAGEQPITCRPADRLAPEMERLAAELKE
KAGTDAVRLAEGERETDDVLTYALFPQIGFKFLAHRDDPSAFEPAPQAPGETPPPSRDES
PATAPSAAPRAPETYTVTVNGKAYVVEVAEGGEVSQVAARADASPAAAPAPASGEAITAP
LAGNIFKVNVAAGDSVAEGDVVIILEAMKMETEVRAAQAGTVSAVAVKEGDSVAVGDELI
RL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatactcaacgtccgctgggcattaccgacgtggtgctgcgcgacgcgcaccaa
tccctcttcgccacgcgcatgcgcctggacgacatgctgcccatcgccgagaaactcgac
cgcgtgggattctggtcgctggaatcctggggcggcgcgactttcgacgcctgcattcgc
tatctgggcgaggacccctgggcgcgtattcgggctctgaaggaagccatgcccaacacc
ccgcagcagatgctgctgcgaggtcagaacctgctcggctatcggcactacgccgacgac
gtggtcgatgcgttcgtcgagcgtgcccgggccaatggcgtggatgtgttccgggtcttc
gacgccatgaacgacacccgcaatctggaacgcgcgctcaaggccgtggtggcttgcgag
ggacatgcccagggcaccctggcgtacaccgtgagccccgtgcacaccctggaaagctgg
ctggacatggccaagcgcatcgaggacatgggcgcgcactcgctggcgatcaaggacatg
gccggtctgctgacgccctacatggcgcatgagctggtctcgcggctcaagcagaccgtg
gccttgcccatccatgtgcattgccatgccaccacggggctttccaccgcgacgctgctc
aaggccgtcgaggccggcgccgacaccgtcgacacggcgatctcgtcgatggcgatgacc
tacggccacagccccaccgagtccctggtggcgatgctgcgcgagacgccgcgcgatacc
gggctcgacctcgagctgctcgaggacatcgccgcctattttcgtgaggtgcgcaagaaa
tacacggcgttcgaaggctcactgcgcggcatcgactcgcgcatcctggtggcgcaggtg
cccggcggcatgctcaccaacatggaaggccagctcaaggagcaaggcgcgggagaccgg
ctcgacgaggtgctcggcgaaattccccgcgtgcgcgaggacctggggtacattcccctg
gtcacgcccacgtcgcagatcgtcgggacccaggcggtgatgaacgtgatgatgggcagc
cgctatcagtcgatctccaaggaggtgcaggcgctgctcaagggtgaatacggcgccgcg
ccggcgcccttcgatgcggacttgcaggcgcgtgccctggcgggagagcagccgatcacc
tgccgacccgccgaccgtctcgcgccggagatggaacgcctcgcggcggagctcaaggaa
aaggccgggacggacgcggtacgtctggccgagggcgagcgcgagaccgacgacgtgctc
acctacgcgctgttcccgcagatcggcttcaagttcctcgcccaccgtgacgacccctcg
gcgttcgagccggcaccgcaagcgccgggggagacgccgccgccatcccgtgacgagtcg
cctgccacggcaccgtccgccgcgccccgcgcgcctgaaacctataccgtcactgtcaac
ggcaaggcctacgtggtcgaggtggccgagggcggcgaggtctcgcaggtggctgcccgg
gcggacgcgtcgcccgcggcggcgcctgcgccggccagcggcgaggcgatcactgcgccg
ctggccggcaacatcttcaaggtcaatgtcgccgccggcgacagcgtcgccgagggcgat
gtggtgatcatcctcgaggcgatgaagatggaaaccgaagtgcgcgcggcacaagcgggc
accgtctccgccgtcgcggtcaaggagggcgacagcgtcgccgtcggtgacgaactgatc
cgtttgtga

DBGET integrated database retrieval system