KEGG   Chromohalobacter salexigens: Csal_0796Help
Entry
Csal_0796         CDS       T00347                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00860  Porphyrin and chlorophyll metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
Module
csa_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Csal_0796
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Csal_0796
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Csal_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored Thi4 HI0933_like FAD_binding_2 Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA AlaDh_PNT_C Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABE58153
UniProt: Q1QZF5
Position
891294..892724
Genome map
AA seq 476 aa AA seqDB search
MQHEEQLDATDQAVGEARRDVVVVGGGASGLAAARAAARRGLAVSVLERGSHAGGNLRTH
RDGAWQVEVGPNTLVMKPPLHTLLDELGLLDEAQPANPDARRRYIAFHGRPVALPTHVLK
APANPLIGLRGSWSVLREPFRAGPPRDEESLADFVVRRLGRHVLDHLVDPFVSGVYAGDP
ARLSAQAAMPRLVALEREYGSLVRGGLRRLRQSRREPPALPREWRGQLVSFPAGLQRLAE
RLAEDIADQPGASVQCGCEVVAVGREADGWQVETAAGQRIRTRELVLAVPAPTAAALLAP
LDAALAAPLEEIAYPPVNAVSVGFRRADVDHPLDGFGMLIPGVERRRTLGALFSSTLFPG
RAPSDHVLLTAFLGGRRQPEAAAGDDAEQVAQVVADLGDLLGIHAEPVWQCVSRWPQAIP
QYERGHLARIAALDAALEAHPGLSLLGNWRDGIAVGDCLENGRRLGERLAETPDRR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatgaagaacagctcgatgcgaccgaccaggcggtcggcgaggcacggcgcgac
gtggtcgtcgtcggcggcggggccagcggcctggccgctgcccgggcggcggccaggcgc
gggctcgctgtcagcgtgctcgagcgcgggtcgcacgcgggtggcaatctgcgcacccat
cgcgacggggcgtggcaggtcgaggtcggtcccaacacgctggtgatgaagccgccgctg
cacacgctgctcgacgagctgggactgctcgacgaggcccagccggccaatcccgatgcg
cggcgtcgctatatcgccttccatggacgcccggtggccttgcccactcatgtcctcaag
gcgcccgccaacccgttgatcggcctgcgcggcagctggtccgtgctgcgcgagcccttt
cgggcggggccgccacgcgacgaggaaagcctggcggacttcgtcgtgcgacgcctggga
cgccacgtgctcgaccatctggtcgacccctttgtctcaggcgtttatgccggcgatccc
gcccggctctccgcgcaggcggcgatgccccggctggtggcgctggagcgcgagtacggc
tcgctggtgcgaggcgggctgcgccggctacgccagtcgcgtcgcgagccgcccgccctg
ccacgcgagtggcgcggacaactggtgagtttccctgccgggctgcaacgccttgctgag
cggctggcggaggacatcgccgatcagcccggggcgtcggtacagtgcggctgcgaggtc
gtcgccgtgggccgcgaggccgacggctggcaggtggaaacggccgccggccagcgcatt
cgcacgcgcgaactggtgctggcggtgccggcccccacggcggcggcgctgctggccccc
ctcgacgcggccctggctgcccccctggaggaaatcgcctatccaccggtcaacgcggtc
tcggtgggatttcgccgggccgacgtcgaccatcctctcgatggcttcggcatgttgatt
cccggggtcgagcggcggcgtacgctgggggcactgttttcctcgacgctgttccccggg
cgtgcgccgtcggatcatgtgctgctgacggcctttctgggaggccggcgccagccggag
gccgccgccggcgacgatgcggagcaggtcgctcaggtggtggccgatctcggcgatttg
ctgggaattcacgccgagccggtgtggcaatgcgtgagccgctggccacaggcgattccg
cagtacgagcgtgggcacctggcgcggattgccgccctggacgcggctctggaagcgcat
cccggcctctcgctgctcggcaactggcgtgacggcatcgcggtgggggattgcctggaa
aacggccggcgtctcggcgagcggctcgccgagacgccggatcggcgctga

DBGET integrated database retrieval system