KEGG   Chromohalobacter salexigens: Csal_0865Help
Entry
Csal_0865         CDS       T00347                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00010  Glycolysis / Gluconeogenesis
csa00620  Pyruvate metabolism
csa00640  Propanoate metabolism
csa00680  Methane metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01130  Biosynthesis of antibiotics
csa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csal_0865
   00620 Pyruvate metabolism
    Csal_0865
   00640 Propanoate metabolism
    Csal_0865
  Energy metabolism
   00680 Methane metabolism
    Csal_0865
Enzymes [BR:csa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Csal_0865
Lipid biosynthesis proteins [BR:csa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Csal_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABE58222
UniProt: Q1QZ86
Position
968777..970726
Genome map
AA seq 649 aa AA seqDB search
MTEQQKVYPVAEEFAANAWADNETYLSLYQRSVDDPEGFWAEQAESLEWFKTPTKIKNTS
FASSNVDIRWFEDGELNASYNCLDRHLETRGDQPAIIWEGDDPSHDKTITYRELHAQVCR
LGNALKEMGVGKGDTVTLYMPMIPEAAVAMLACARIGAVHSVVFGGFSPDALAQRVVDAQ
SRVVITADESVRGGKHVPLKDNVDAALTRDGTDIVEKVLVVQRTGGDIEWHDGRDAWYHE
WVERQSSECPAERMNAEDALFILYTSGSTGRPKGLKHTTGGYLLYAALTHRYVFDYHDGE
VYWCSADVGWVTGHSYIVYGPLANGATTLMFEGVPSYPSHGRLGEIVDKHGVSILYTSPT
AIRALMAHGENIMDSSRRDTLRVLGSVGEPINPEAWSWFHRVIGNSRCPIVDTWWQTETG
GIMITPLPGATDLKPGSATRPFFGVQPALLDNDGNLLEGATSGNLVILDSWPGQARTIWN
DHERFVQTYFSAYEGVYFTGDGCRRDEDGYYWITGRIDDVLNVSGHRMGTAEIESSLVAH
SAVAEAAVVGYPHDIKGQGIYIYVTLSDDAEPSEELRKELTQWVRKDIGPIATPDVIQWA
PGLPKTRSGKIMRRILRKIAANECEGLGDTSTLADPSVVDELIEHRANR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagcagaaagtctacccggtggcggaggagttcgccgccaatgcctgggcg
gataacgagacttacctgagcctctatcagcgctccgtcgacgatcccgagggcttctgg
gccgagcaggccgagtcgctggaatggttcaagacgccgaccaagatcaagaacacgtca
ttcgcgtcatccaacgtggatatccgctggttcgaggatggcgaactcaatgcctcctac
aattgcctcgaccgccacctcgagacgcgtggcgatcagccggcgatcatctgggagggc
gacgacccgagccacgacaagaccatcacctaccgcgagctgcatgctcaggtctgtcgg
ctgggcaacgcgctcaaggagatgggcgtcggcaagggggacaccgtcacgctctacatg
ccgatgatccccgaggcggcggtcgccatgctggcgtgtgcccgcatcggggcggtgcac
tcggtggtgttcggcggcttctcgccggatgccctggcgcaacgcgtggtcgatgcccag
tctcgcgtggtcattaccgccgacgagtcggtacgcggcggcaagcacgtaccgctcaag
gacaatgtcgatgcagcgctgacacgcgacggcaccgatatcgtcgagaaggtgctggtg
gtccagcggaccggcggcgacatcgagtggcacgacggtcgcgacgcctggtaccacgag
tgggtcgagcgccagtcgagcgaatgcccggccgagcggatgaacgccgaggatgccttg
ttcatcctgtatacctcgggctccaccggccgtcccaaggggctcaagcataccaccggg
ggctatctgctctacgcggcactgacgcaccgctacgtgttcgattaccacgatggcgag
gtgtactggtgcagcgccgacgtggggtgggtgaccgggcacagctacatcgtctatggc
cccctggccaacggcgccaccacgctgatgttcgaaggcgtgccgagctatccctcgcac
gggcgtctcggcgagatcgtcgacaagcacggcgtgtcgattctctatacgtcgccgacg
gcgattcgtgccttgatggcgcacggcgagaacatcatggactccagccggcgcgacact
ctgcgcgtgctggggtcggtgggcgagccgatcaatcccgaggcatggagctggttccac
cgggtgatcggcaattcgcgctgcccgatcgtcgatacctggtggcagaccgagaccggc
gggatcatgatcacgccgctgcccggtgccaccgacctcaagccgggctccgccacacgg
ccgttcttcggtgttcagccggcgctgctcgacaacgacggcaacctgctcgaaggcgcc
acgtccggcaacctggtgatcctcgactcctggccggggcaggcgcgcaccatctggaac
gaccacgagcgtttcgtgcagacgtacttctccgcctatgaaggcgtctatttcacgggt
gacggctgccgccgcgacgaggacggctattactggatcaccgggcgcatcgacgacgtg
ctcaacgtgtccggccatcgcatgggaaccgcggaaatcgagtcgtccctggtggcgcac
agcgccgtggccgaggcagccgtggtagggtacccgcacgacatcaagggccagggcatc
tatatctacgtgaccctgagcgacgatgccgaacccagcgaggaattgcgcaaggagctc
acccagtgggtgcgcaaggacatcggcccgatcgcgacgccggatgtcattcagtgggcg
ccgggcctgcccaagacgcgctccggcaagatcatgcggcgcattttgcgcaagattgcc
gccaatgagtgcgaaggcctgggggatacgagtacactggcggatccgagcgtggtcgat
gagttgatcgagcaccgcgccaatcgttga

DBGET integrated database retrieval system