KEGG   Chromohalobacter salexigens: Csal_1170Help
Entry
Csal_1170         CDS       T00347                                 

Definition
(GenBank) DNA helicase/exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csa  Chromohalobacter salexigens
Pathway
csa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:csa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Csal_1170
Enzymes [BR:csa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Csal_1170
DNA repair and recombination proteins [BR:csa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Csal_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD AAA_22 UvrD_C AAA_16 AAA_28 UvrD-helicase T2SSE CbiA DUF2075 TrwB_AAD_bind NACHT AAA_33 AAA_29 NTPase_1 AAA_5 AAA ATPase
Motif
Other DBs
NCBI-ProteinID: ABE58526
UniProt: Q1QYD2
Position
1342207..1344174
Genome map
AA seq 655 aa AA seqDB search
MSPDQYTLALDASPGMSRESLFESLAWWEALGWLRPLDAHFARFLAEHDARAPVEVLLAA
ALASHQLGRGHVCLTLPRALAAPRDVLSLPPLEEDAPHESVPLPDDFLRGLESATWAARL
AESPLVASPGPGTTPLVLVGERLYLRRYWRAEQAVATHLGARLGRPLPVEASLAAPLARL
FSANGASEDAPDWQKVACTLALRNRLTIISGGPGTGKTTTVTRLLALLQTQALAASRGER
ALRIQLAAPTGKAAARLSESIAGAMSGLDVEADVAATLPREALTLHRLLGARPDTRQFRH
HAGQPLSLDLLVVDEASMVDLELMAALLEALPDEARLILLGDKDQLASVEAGSVLGDLCA
NALDQGYSPAACEVLSQLADTDMTPDPACSPLADHVVMLRKSFRFDAHSGIGALAAATND
GDVAAFRQAWQAQYTDIQWLASSNAQREVERAALAGYRDFYRRVRDGASPADVLARLNDF
QVLCALKRGPWGVEGLNARIAAGLWREGWIEDPQGWYAGRPVMVTRNDPQLGLYNGDIGI
ALPDAEAGRRLRVFFATAGGVRAVLPSRLDACETVFAMTVHKSQGSEFTHVMFVLPERAN
PILTRELVYTGITRARQRLTLAGGGASVVESALTRRVVRDSGFAEWVAALDWPRD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgagcccagaccaatacacgctggcactggatgcctcgccgggcatgagccgggagtcg
ctcttcgagagtctggcctggtgggaagcgctgggctggctgcgtcccctggatgcgcat
ttcgcgcgctttctggcggaacacgatgcccgggcgccggtcgaggtattgctggcggcg
gccctggccagccaccaactggggcgcggacatgtctgcctgaccctgccgcgggcactc
gctgctccgcgcgacgtgctgtcgttgccgcctctggaagaggacgctccgcacgagtcg
gtcccgttgccggacgacttcctgcgcggtctggagagcgcgacctgggccgcgcggctg
gccgagtcgccgctggtggcgtcgcccgggccgggcaccacgcccttggtgctggtcggc
gaacgtctgtacctgcggcgctactggcgcgccgagcaggccgtggccacgcacctcggc
gcgcgtctggggcgcccgttgccggtggaggcctcgctggccgcaccattggcgcggctg
ttctcggccaatggcgcctcggaggacgcgccggactggcagaaggtggcctgtacgctg
gcgttgcgcaaccggttgacgatcatctccggtggtcccggaaccggcaagacgacgacg
gtgacgcgcttgctggcattgctccagacgcaggcgctggcggcctcccgaggcgagcgt
gcgctgcgcattcaactggcggcgcccaccggcaaggcggcggcgcgcttgtccgagtcc
atcgccggcgccatgagcggtctggatgtcgaagccgacgtggcggcgacgctaccgcgc
gaggcgctgacgctgcatcggctgctgggcgctcgtcccgatacgcgacagtttcgccat
cacgcggggcaaccgctgagcctcgacctgctggtggtggacgaggcctcgatggttgac
ctggaactgatggcggcgctgctcgaggccctgcccgacgaggcgcgcctgatcctgctc
ggcgacaaggaccagcttgcctcggtggaggccggctcggtgctgggcgatctctgcgcc
aatgcgctggaccagggctattcgccggccgcctgcgaagtgctgtcgcaactggcggat
accgacatgacgcccgacccggcatgttcgccgctggcagaccacgtcgtcatgctgcgc
aagagtttccgcttcgacgcgcacagcggtatcggtgccctggccgcggccaccaacgac
ggcgatgtcgcggccttccgccaggcctggcaagcgcagtacacggacatccagtggctg
gcatcctcgaacgcccagcgcgaggtcgagcgtgccgccttggcggggtatcgcgatttt
tatcgccgcgtgcgcgacggggcgtccccggccgacgtgctggcgcggttgaacgacttt
caggtgctgtgcgccctcaagcgcgggccctggggtgtcgaggggctcaatgcccgtatc
gccgccggcctgtggcgtgaaggctggatcgaggacccgcaaggctggtatgccgggcgc
ccggtgatggtgacgcgcaacgacccgcagctggggctctacaatggcgatatcggcatc
gccctgccggatgccgaggcggggcggcgcctgcgtgtgttcttcgcgactgccggtggc
gtccgggccgtgctgccatcgcggctcgacgcctgcgagacggtattcgcgatgacggtg
cacaagtcgcaaggctccgagttcacgcacgtgatgttcgtgctgcccgaacgcgccaat
ccgatcctgacccgcgagctggtgtataccggcatcactcgggccaggcagcgcttgacg
ctggccgggggcggcgcgagcgtcgtcgagagtgctctgacgcgacgcgtggtgcgcgac
agcgggttcgccgagtgggtggcggccctggactggccgagggattga

DBGET integrated database retrieval system