KEGG   Chromohalobacter salexigens: Csal_1220Help
Entry
Csal_1220         CDS       T00347                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00020  Citrate cycle (TCA cycle)
csa00640  Propanoate metabolism
csa00660  C5-Branched dibasic acid metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01130  Biosynthesis of antibiotics
csa01200  Carbon metabolism
Module
csa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Csal_1220
   00640 Propanoate metabolism
    Csal_1220
   00660 C5-Branched dibasic acid metabolism
    Csal_1220
Enzymes [BR:csa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Csal_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABE58575
UniProt: Q1QY83
Position
1398168..1399397
Genome map
AA seq 409 aa AA seqDB search
MTATSWVAATIRVTCNQWHDTMNLHEYQSKQLFADYGLPVSKGFAVDTPEEAAEACKKIG
GDKWVVKAQVHAGGRGKAGGVKLVESPADAKAFAEQWLGKNLVTFQTDEKGQPVAKILVE
NCTDIANELYLGAVVDRGTRRIVFMASTEGGVEIEKVAEETPEKILKAEIDPLVGAQPYQ
ARELAFALGLEGAQIKQFTKIFLGLAKLFQEKDLALLEINPLVITDEGNLHCLDAKIGLD
GNALYRHPDLQAMRDPSQEDEREAHAQEWELNYVALEGNIGCMVNGAGLAMGTMDIIKLN
GGQPANFLDVGGGATEERVGEAFKIILSDDSVKAVLVNIFGGIVRCDMIAEGIIGAVEQV
GVNVPVVVRLEGNNAELGAEKLASSGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgacctcgtgggtggccgccaccattcgagtcacatgcaaccaatggcatgac
acgatgaaccttcacgagtatcagagcaaacagctgtttgccgattatggtctaccggtg
tccaagggtttcgccgtggatacccccgaagaagccgccgaagcgtgcaagaagatcggt
ggtgacaagtgggtcgtcaaggcccaggttcacgcgggcggccgcggcaaggccggcggc
gtcaagctggtcgaaagccccgccgacgccaaggccttcgccgagcagtggctgggcaag
aacctggtgaccttccagactgacgagaagggtcagccggtcgccaagatcctggtcgag
aactgcaccgacatcgccaacgagctgtacctgggcgccgtcgtcgaccgtggcacccgc
cgcatcgttttcatggcttccaccgaaggtggcgtggaaatcgagaaggttgccgaggaa
actcccgagaagattctcaaggccgagatcgatcccctggtcggcgctcagccgtatcag
gcgcgtgagctggccttcgcgctgggtctcgaaggcgcgcagatcaagcagttcaccaag
atcttcctggggctggccaagctgttccaggaaaaggatctggcgctgctcgagatcaat
ccgctggtgatcaccgacgaaggcaatctgcattgcctcgacgccaagatcggtctggac
ggcaatgccctgtatcgccaccccgatctgcaggcgatgcgtgacccgtctcaggaagac
gagcgcgaagcgcatgctcaggagtgggaactcaactacgtcgccctggaaggcaacatc
ggctgcatggtcaacggtgccggcctggccatgggcaccatggacatcatcaagctcaac
ggcggccagccggccaacttccttgacgttggcggcggtgcgacggaagagcgcgtcggc
gaggcgttcaagatcatcctgtccgacgattccgtgaaggccgtcctggtcaacatcttc
ggcggcatcgtccgttgcgacatgatcgccgaaggcatcatcggtgccgtcgagcaggtc
ggtgtcaacgtgccggtcgtggtgcgtctcgagggcaacaacgccgagctgggcgccgag
aaactggcatccagtggactgaacatcatcgctgctaccagcttgaccgacgcggcccag
caggtcgtcaaagcagcggagggcaagtaa

DBGET integrated database retrieval system