KEGG   Chromohalobacter salexigens: Csal_1260Help
Entry
Csal_1260         CDS       T00347                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01130  Biosynthesis of antibiotics
csa01230  Biosynthesis of amino acids
Module
csa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Csal_1260
Enzymes [BR:csa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Csal_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI
Motif
Other DBs
NCBI-ProteinID: ABE58615
UniProt: Q1QY43
Position
1438795..1439430
Genome map
AA seq 211 aa AA seqDB search
MTSPMQRTRVKICGLTREEDIDAAVAAGADALGFVLWPGSSRAIDEARLARLAARVPAFV
TRVGLFVDQADDEIRRYARHLDLVQLHGNESPDDCARLDTPWIKALRMRDGIDLHAEMSR
YDAARGLLLDAYRPGVPGGTGETFDWSRIPANLAKPVILAGGLTADNVAEAIHRVRPYAV
DVSGGVEAAKGLKDPARIRAFLSQVSHTQAP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgccgatgcagcgtacgcgcgtcaagatctgcggcctgacccgggaggaggac
atcgacgccgcggtggcggcgggcgccgatgcgctggggttcgtcctgtggccgggcagc
tcgcgggccatcgacgaagcccggctggcgcgcctggccgcccgcgtgccggcgttcgtg
acccgggtggggctgttcgtcgaccaggccgatgacgagattcggcgctacgcacgccac
ctggatctcgtgcagctccacggcaacgaatcccccgacgactgcgcgcgtctcgatact
ccctggatcaaggcactgcgcatgcgcgacggcatcgacctgcatgccgagatgtcccgt
tacgatgcggcgcgcggtctgctgctggatgcctaccgccccggcgttcccggaggcacc
ggggagaccttcgactggtcgcgaatccccgcaaacctggcaaaacctgttattctcgcg
ggaggcttgacggcggacaacgtcgccgaagccattcaccgggtccggccctatgccgtc
gacgtctcgggaggcgtcgaggcggcaaagggtctcaaggatcctgcgcgcatccgggca
tttctgtcccaagtgtcccatacccaagccccatag

DBGET integrated database retrieval system