KEGG   Chromohalobacter salexigens: Csal_1525Help
Entry
Csal_1525         CDS       T00347                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00900  Terpenoid backbone biosynthesis
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Csal_1525
Enzymes [BR:csa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Csal_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABE58878
UniProt: Q1QXD0
Position
complement(1737249..1738145)
Genome map
AA seq 298 aa AA seqDB search
MQRLSLPAPAKLNRMLHIVGRRADGYHELQTLFQFLDRSDTLHFSPRADGAIHLAPAIAD
VDHDANLIVRAARLLQHASGTHQGVDIHLDKRLPMGGGLGGGSSDAATTLLALDRLWSLD
LGLPRLAELGLTLGADVPVFVRGHSAWAEGIGERLTPVTLDTPWFVVIHPGEEIATPAVF
GHPELTRDTPPISMARALRGGAEQGRAWRNDCEAVVRRLSPDVAHALDWLSAFGPAMLTG
TGSCLFCPLTSERQADRILRRVGSHWHAFKARGCNTSPLHDALGIHDEWSPMSQYGDA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcctcagcctgccggcgcccgccaagctcaatcgcatgctgcatatcgtgggc
cgccgtgccgacggctaccacgagctgcagacactgttccagtttctcgaccggagcgac
acgctgcacttcagcccccgcgctgacggcgccattcacctggccccggccatcgcggac
gtcgatcacgacgccaacctcatcgtgcgcgccgcccgtctgctgcagcacgcaagcggc
acgcatcagggcgtggacattcacctcgacaaacggctccccatgggaggcggcctgggc
ggcggcagctccgacgcggccaccaccctgctcgcgctcgaccgcttgtggtcgctcgac
ctggggctgccccgtctcgccgagctgggtctcacgctcggcgccgacgtgccggtcttc
gtgcgcgggcacagcgcctgggccgaaggtatcggcgaacgccttacgccagtgacgctc
gacaccccctggttcgtggtcatacacccgggcgaggaaatcgccacgcccgccgtgttc
gggcaccccgaattgacacgcgacaccccgccgattagtatggcgcgcgcactgcgaggg
ggagccgaacaggggcgcgcctggcgcaatgactgcgaagccgtggtgcgacgcctctcg
ccggacgtcgcacatgcgctcgactggttatcggccttcggtccggccatgctcacggga
acgggcagttgccttttctgtcccttgacgagcgaacggcaagccgataggattttgcgc
cgtgttggcagccactggcatgcgttcaaggcacgcggctgcaacacttctcccctccat
gacgctctgggcattcacgacgaatggtcacccatgagccaatacggggacgcctga

DBGET integrated database retrieval system