KEGG   Chromohalobacter salexigens: Csal_1536Help
Entry
Csal_1536         CDS       T00347                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00130  Ubiquinone and other terpenoid-quinone biosynthesis
csa00627  Aminobenzoate degradation
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Csal_1536
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Csal_1536
Enzymes [BR:csa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Csal_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DUF3439
Motif
Other DBs
NCBI-ProteinID: ABE58889
UniProt: Q1QXB9
Position
1749198..1749824
Genome map
AA seq 208 aa AA seqDB search
MADEAMFEAPVTVALTGASGAQYGLRLIDCLVAARHQVLVLISKAAHMVIATETDESLPS
NPERLSEALRERSGAAPGQIRCFAREDWMAPVASGSGAPSAMVICPCSTGTLSAVATGAS
NNLIERAADVALKERRQLILVPRETPFSAIHLEHMLTLTRMGAVILPAAPGFYHRPQTLD
DMIDFIVARILNQLGIAHALMPRWGEAT
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaagcaatgttcgaagcgcctgtcaccgtggcgttgacgggggcatccggg
gcgcagtacgggctgcggctcatcgactgcctggtggcggcgcggcatcaggtgctggtg
ctgatctccaaggccgcgcacatggtcatcgccaccgaaaccgacgagagcttgccgtcg
aaccccgagcgcttgagcgaggcgctgcgggagcgaagcggtgccgcgccgggccagatt
cgctgcttcgcccgggaggactggatggcgcccgtggcctcggggtccggtgcgcctagt
gccatggtgatctgcccctgttcgacgggaacgctctcggcggtcgccaccggcgcgagc
aacaacctgatcgagcgcgccgcggacgtggcgctcaaggaacggcgtcagctcatcctc
gtcccacgcgagacgccgttctcggccattcatctcgagcacatgctgacgctgacccgg
atgggcgcggtgatactccccgcggcccccgggttctaccaccgcccacagacgctcgac
gacatgatcgacttcatcgtggcgcgcattctcaatcaactgggcattgcgcatgctctg
atgccgcgctggggagaagccacatga

DBGET integrated database retrieval system