KEGG   Chromohalobacter salexigens: Csal_2188Help
Entry
Csal_2188         CDS       T00347                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00473  D-Alanine metabolism
csa00550  Peptidoglycan biosynthesis
csa01100  Metabolic pathways
csa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Csal_2188
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Csal_2188
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Csal_2188
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csa01011]
    Csal_2188
Enzymes [BR:csa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Csal_2188
Peptidoglycan biosynthesis and degradation proteins [BR:csa01011]
 Precursor biosynthesis
  Amino acid ligase
   Csal_2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 RimK ATP-grasp ATP-grasp_4 ATPgrasp_YheCD GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ABE59539
UniProt: Q1QVG9
Position
complement(2462538..2463482)
Genome map
AA seq 314 aa AA seqDB search
MSDTVTDGDASRRRHGRVVVVYGGRSAEREVSLLSGGAVLASLVRSGVDAHGFDFAGGGL
SGLEALAPDRVFIAMHGRDGEDGSLQGALELLGIPYTGSGVLASALGMDKERTKQLWRAH
GLPTPESVMLEGEPDWDAVIEALGLPLIVKPVHEGSTIGISIVETRDALIAAHAEASRFD
SAIMAERFVQGEEYTVSLLGDEVLPAIRVEVPSGFYDYEAKYHSDTTRYLLPCGLEQEEE
RMLGDVCRRAFEAIGGRGWGRVDVMRDAQGRFWLLEVNTVPGMTDHSLVPQAAAHAGLDF
DALVLRILDTTTGS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaccgtaacggatggagacgcttcacgtcgtcggcacgggcgtgtcgtggtg
gtctacggtggccgctccgcagagcgcgaggtctcgctgctgagcggcggagcggtgctg
gcatcgctcgtgcgcagcggggtcgatgcgcacgggttcgatttcgccgggggaggtctg
agcggtctcgaagcgctggcccccgatcgcgtcttcatcgccatgcatggccgcgacggc
gaggacggttccttgcaaggcgcgctggaactgctggggattccctatacgggcagcggc
gtgctggcctccgcgctgggcatggacaaggaacgcaccaagcagctttggcgcgcccat
ggtctgcccacgcccgaaagcgtgatgctcgagggcgagcccgactgggatgccgtgatc
gaggccctggggttgcccttgatcgtcaagccggtgcacgaaggctcgacgatcggcatc
agcatcgtcgagacgcgtgatgcactgatcgctgcgcatgccgaggcgtcgcgcttcgat
agcgcgatcatggcggaacgtttcgttcagggcgaggaatatacggtgtcgctgctcggc
gacgaggtgctgccggcgattcgcgtcgaagtgccgagcggtttttacgactacgaggcc
aagtatcattccgatacgacgcgctatctgttgccctgcgggttggagcaagaagaagag
cgcatgctgggtgatgtctgccgccgcgccttcgaggcgatcggggggcgtggctgggga
cgcgtcgatgtgatgcgcgacgcccagggacgcttctggttgctcgaggtcaataccgtt
cccggcatgaccgaccatagcctggtcccccaggcggcggcgcatgcggggctcgatttc
gatgcactggtgttgcgaattctcgacaccactaccggcagttga

DBGET integrated database retrieval system