KEGG   Chromohalobacter salexigens: Csal_2241
Entry
Csal_2241         CDS       T00347                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00970  Aminoacyl-tRNA biosynthesis
csa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Csal_2241
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:csa03029]
    Csal_2241
Enzymes [BR:csa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Csal_2241
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Csal_2241
Mitochondrial biogenesis [BR:csa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Csal_2241
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-ProteinID: ABE59592
UniProt: Q1QVB6
Position
2514749..2515036
AA seq 95 aa
MAIEHADVLRAAHLARVGLGEDEATGYVDDLSRILEMVDQLQAVDTQGIAPLAHPLDATQ
RLRPDEVTEHNQRERFQACAPVTEGGLYLVPRVVE
NT seq 288 nt   +upstreamnt  +downstreamnt
atggcgatcgaacatgcagacgtgctccgtgccgcccatctggcccgtgttggcctcggc
gaggacgaagcgaccggctatgtcgacgacttgagccgcatcctggaaatggtagatcaa
ctccaggccgtcgacacccagggcatcgcgcccttggcacaccctttggatgccacgcag
cgcctgcggcccgacgaagtgaccgaacacaaccagcgtgagcgcttccaggcctgcgcc
cccgtcaccgagggcggtctctacctcgtcccgcgcgtcgtcgaatga

DBGET integrated database retrieval system