KEGG   Chromohalobacter salexigens: Csal_2260
Entry
Csal_2260         CDS       T00347                                 

Definition
(GenBank) OmpA/MotB
  KO
K11891  type VI secretion system protein ImpL
Organism
csa  Chromohalobacter salexigens
Pathway
csa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:csa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Csal_2260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csa02044]
    Csal_2260
Secretion system [BR:csa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Csal_2260
SSDB
Motif
Pfam: IcmF-related_N IcmF-related OmpA MMR_HSR1 DUF1772 DUF4131
Other DBs
NCBI-ProteinID: ABE59610
UniProt: Q1QV98
Position
complement(2537550..2540042)
AA seq 830 aa
MKRFKFAYIKYAFFKYQPYILGLLFFATIFVVWWLGVALGFSSLASLLCGIVLFLLASAF
YVLLLYRGVGQKRNLEHLLREDADAAVLDASPQDREEISLLRERLLKTIERLKKSGKSKG
KRGNDALYALPWYMIVGQPAAGKSTMVYESGLNFPFAERENARVAGMGGTRHCDWFFSSD
AILLDTAGRYMNSEEEAGKWKGFLSLLKEHRRHCPLNGLIVAVNISDVVQASDTQRNNLA
RRLRERIQEARDHLEARLPIYLVFTKCDLIEGFTTFFEHLDPQRQSDVLGHTFPHQQPSD
VNWGVQFDAALNELCRHWLQVGDDEIVQRDVVETRRDVAAFRFPLELAALRDPLTRFVDA
LTNANPYQSAPLLRGFYFVSALQEGDAIEGEHASRVGRHFALAKPERLAGERVNHAFFIS
NLFRQVIIADQHLAGLYSSDVRGRRRKLRWTLAAAALGAIACTLWITSAVRNHGEIEAMS
HTFAEAAAEDDDRQAHYARWHSLDALRDWGSHYYQRHQNGGVPWSMGWGLYQGDEIEPAI
RKTYFDRLQSVMLEPVEQNLTRSLFTLTTIGVYRRTADELHAVDGPDTVAPYARPRDNSA
ESLAKFGRNTLDTYLMLSDMERADIDSDVLRNRLPAFWYPAIQRRTGAEIDEGRADYRYA
GRQVDFYSQQIHASDVPRITSNAFLVSSSRNYIDSLLEQTLTSTETIVLESDTLFAFGRG
DYAGLQQAGQQELDKLAERLLNTQDLGQILITGHADPIGNEAANQQLSLQRAMTVRQYLI
GKGVPAGLIEAKGAGSERPLVTCDDDQPRAQLIECLAPNRRVEIEVRKQQ
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgaaacgtttcaaattcgcttatataaagtacgcgttcttcaagtaccagccatatatt
ctggggctgctcttcttcgcgaccatcttcgtggtgtggtggctgggagtggcgctgggc
ttttcgtcgctggccagcctgctatgcggaatcgtgctctttctgttggcctcggcgttc
tatgtgttgctgctctatcgtggcgtggggcagaaacgcaatctcgagcatctgctccgg
gaggacgccgacgcggcggtactcgatgccagcccgcaggatcgtgaagagatcagtctg
ctgcgcgaacgcctgctgaagaccatcgagcgtctcaagaagagcggcaagagcaagggc
aagcggggcaacgacgcgctttacgcgctgccctggtacatgatcgtggggcagcccgcg
gccggcaagagcaccatggtctacgagtcggggctcaactttcccttcgccgagcgcgag
aacgcccgcgtggccggtatgggcgggacgcgtcactgcgactggttcttcagctccgat
gccattctgctggataccgccgggcgttacatgaacagcgaagaggaggccgggaaatgg
aagggcttcctgtcgctgctcaaggaacatcgtcgccactgtccgctcaatggcctgatc
gtcgcggtcaacatcagcgacgtggtgcaggccagcgatacccagcgcaacaatctcgcc
cggcgcctgcgtgaaaggattcaggaagcgcgggaccatctggaagcgcggttgccgatc
tatctggtgtttaccaaatgcgacctgatcgagggcttcacgacttttttcgagcatctc
gatccgcagcggcagagcgacgtgctcggtcataccttcccgcatcagcaacccagtgat
gtgaactggggcgttcagttcgatgccgccctgaatgagctgtgtcgccactggctgcag
gtcggtgacgacgagatcgtgcagcgcgatgtcgtcgagacccggcgcgatgtcgccgcc
ttccggtttccgctcgagctcgccgcgctgcgcgatcctctgacgcgtttcgtcgatgcg
ctgaccaatgccaatccttaccagagtgcgccgctgctgcgtggtttctatttcgtcagc
gcactgcaggaaggcgatgccatcgagggggagcacgccagtcgcgtcggccgtcacttc
gcgctggccaagcctgaaaggctggcgggcgagcgcgtcaaccatgcctttttcatctcc
aacctgtttcgtcaggtcatcatcgctgatcagcatctggccgggctctactccagcgat
gtgcgggggcggcgacgcaagttgcgctggacgttggctgccgctgcgctgggggccatc
gcctgcacgctctggatcacctctgccgtgcgtaaccatggcgagatcgaggcgatgtca
cacaccttcgccgaggccgcggccgaggatgatgatcggcaggctcactatgcgcgctgg
catagcctcgatgcactgcgcgactggggcagccactactatcagcgacatcagaatggg
ggcgtgccctggtcgatgggctgggggctgtaccagggcgacgagatcgagccggcgatc
cgcaagacgtatttcgaccgcctgcaaagcgtgatgctcgaaccggtcgagcagaacctg
acccgctcgctgttcacgctgaccaccatcggggtctatcggcgtaccgccgatgagttg
catgcggtggacgggccggacaccgtggcgccctatgcccgcccgcgcgacaacagcgcg
gagtccctggccaagttcgggcgcaatacgctcgatacctacctgatgctgtcggacatg
gagcgtgccgacatcgacagtgacgtgttgcgcaaccgccttccggccttctggtacccg
gcgatccagcgccggaccggagccgagatagatgaggggcgggccgactatcgctatgcc
ggtcgtcaggtcgatttctacagccagcagattcatgcctccgacgtgccacgcatcacc
tccaatgcgttccttgtctcgagcagccgcaactacatcgacagcctgctggaacaaacg
ttgaccagtacggagaccatcgtgctcgagtccgacaccttgtttgccttcggtcgtggc
gactacgccggcttgcagcaggcgggccagcaggagctggacaaattggccgaacgtcta
ctcaacacccaggacctggggcagatcctgatcaccggtcatgccgatcccatcggcaac
gaggctgccaatcagcagctttctctgcagcgcgcgatgacggtccgtcagtacctgatc
gggaagggcgtaccggccggcctcatcgaagccaagggggcggggagtgaacggccgctg
gtcacttgtgacgacgatcagccgcgtgcgcagttgatcgaatgcctggcaccgaatcgt
cgggtagagatcgaggtgagaaagcagcagtga

DBGET integrated database retrieval system