KEGG   Chromohalobacter salexigens: Csal_2269
Entry
Csal_2269         CDS       T00347                                 

Definition
(GenBank) protein of unknown function DUF877
  KO
K11900  type VI secretion system protein ImpC
Organism
csa  Chromohalobacter salexigens
Brite
KEGG Orthology (KO) [BR:csa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csa02044]
    Csal_2269
Secretion system [BR:csa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Csal_2269
SSDB
Motif
Pfam: VipB VipB_2 TssC TSP_NTD
Other DBs
NCBI-ProteinID: ABE59619
UniProt: Q1QV89
Position
2550036..2551535
AA seq 499 aa
MADNQTDKTSQTDSQEVFAPETSLLDSIISESRVARSETERTRTRDLIDELVNQVLEGEV
TPSKDLIAVLDSRIAEIDALLSDQLNEVMHASEFQQLEASWRGLKYLTDQSETSTNMKIH
MLNASKKDLVKDLKSASEFDQSALFKKVYEEEYGTFGGAPYGMLIGDYEFGRHPQDMYLL
EQVSHVAAAAHAPFISSASPELFGWDSFTDMTGPRDLSKIFDTVEYAKWKSFRNSEDARY
VGLTLPHVLGRLPYGEDTTPVEEFNFTENVDGRDHHKYLWMNAAYTMGARVTDAFSKYGW
CVAIRGVEGGGLVEDLPTHTFQTDDGEVALKCPTEISITDRREKELSDLGFIPLVHCKGT
DYAAFFGTQSAQLPKQYNTDVANANARLSSQLQYIFATSRIAHFMKAIMRDKVGSFASRQ
NVEDYLNEWLSQYVLLDDNAGQEAKAQYPLREARVEVAEVPGKPGSYKAVTFLRPHYQLD
ELTASLRLVSELPQSTRGS
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggccgacaatcagaccgacaagacatctcagaccgacagccaggaagttttcgcaccg
gaaacatcactgctggacagcatcatttccgaaagccgcgtggcgcgttcggaaaccgag
cgcacccggacccgcgacctgatcgacgagctggtcaaccaggtgctcgaaggcgaagtc
acgccgagcaaggacctgatcgcggtcctcgactcgcgtatcgcggaaatcgatgctctg
ctgtccgatcagctcaatgaagtcatgcacgccagcgagttccagcaactcgaggcttcc
tggcgcggtctgaaatatctgaccgatcaatccgagaccagcaccaacatgaaaatccac
atgttgaatgcgtccaagaaggacctggtcaaggacctcaagtcggcgtccgagttcgac
cagagcgcgctgttcaagaaggtctacgaagaagagtacggcaccttcggcggcgccccc
tacggcatgctgatcggagattacgaattcggccgccacccgcaggacatgtatctgctg
gaacaggtctctcatgtcgcggctgccgcacacgcccccttcatctcctcggcctcgccg
gagctgttcggctgggactccttcaccgacatgaccggcccgcgcgatctgtcgaagatc
ttcgacaccgtcgagtatgccaagtggaagtcgttccgcaattccgaagacgcgcgctac
gtgggcctgaccctgccccacgtactgggccgcttgccctacggcgaggacaccaccccg
gtggaagaattcaacttcaccgagaacgtcgacggtcgcgaccaccacaagtacctgtgg
atgaacgccgcctataccatgggcgcccgcgtcaccgatgcattttccaagtacggctgg
tgcgtcgcgatccgcggtgtcgaaggtggcggtctggtcgaggacctgccgacccacacc
ttccagaccgacgatggtgaagtggcgctgaagtgccccaccgagatctcgatcaccgac
cgtcgcgaaaaggagttgtccgacctgggcttcatcccgctggtgcattgcaagggcacc
gactatgcggcgttcttcggcacccagtccgcgcagttgcccaagcagtacaacaccgat
gtggccaacgccaacgcgcgcctctcctcgcagctgcagtacatcttcgccacctcgcgt
atcgcccacttcatgaaagccatcatgcgcgacaaggtcggcagcttcgcgtcccgccag
aacgtcgaggactatctcaacgagtggctgtcgcagtacgtgctgctggacgacaacgcc
ggccaggaagccaaggctcaatacccgttgcgtgaggcacgtgtggaagtcgccgaggtg
cccggcaagcctggttcatacaaggcggtcaccttcctgcgtccgcactatcagctagac
gagctgaccgcatcactgcgcctggtttccgaactgccgcagtcgacgcgaggctcctga

DBGET integrated database retrieval system