KEGG   Chromohalobacter salexigens: Csal_2393Help
Entry
Csal_2393         CDS       T00347                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00071  Fatty acid degradation
csa00280  Valine, leucine and isoleucine degradation
csa00281  Geraniol degradation
csa00310  Lysine degradation
csa00362  Benzoate degradation
csa00380  Tryptophan metabolism
csa00410  beta-Alanine metabolism
csa00640  Propanoate metabolism
csa00650  Butanoate metabolism
csa00903  Limonene and pinene degradation
csa00930  Caprolactam degradation
csa01040  Biosynthesis of unsaturated fatty acids
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01130  Biosynthesis of antibiotics
csa01200  Carbon metabolism
csa01212  Fatty acid metabolism
Module
csa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Csal_2393
   00650 Butanoate metabolism
    Csal_2393
  Lipid metabolism
   00071 Fatty acid degradation
    Csal_2393
   01040 Biosynthesis of unsaturated fatty acids
    Csal_2393
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Csal_2393
   00310 Lysine degradation
    Csal_2393
   00380 Tryptophan metabolism
    Csal_2393
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Csal_2393
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Csal_2393
   00281 Geraniol degradation
    Csal_2393
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Csal_2393
   00930 Caprolactam degradation
    Csal_2393
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Csal_2393
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Csal_2393
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Csal_2393
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Csal_2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABE59740
UniProt: Q1QUW8
Position
complement(2683196..2685379)
Genome map
AA seq 727 aa AA seqDB search
MIYQGNAITVVQRDDGIATLTFDAQGESVNTLSSKTIEEFEAALAALDQAAGVKGLVIAS
AKDAFIVGADITEFHGMFTRDEAFLVDMNTRVHRIFNTLEDLPYPSVAAINGLALGGGCE
ITLACDFRVMSDNAKLGLPETKLGILPGWGGCVRLPRLIGADNAIEWIAGGSENRADDAL
KVGAVDAVVSGDALMNAAVDLLTRANAGELDHRARRRLKQSPLMLNAIEQMMVFETAKGY
VAGKAGPHYPAPIEAIKVIQKGAGEERERAQAIEAKAFAKLAKTDVCYHLVGLFLNDQLV
KKKGKQYAMQAAAVNKTAVLGAGIMGGGIAYQSAYKGTPILMKDIKEEALQLGLKEARKL
LGKQLERGRLSNEQVAEALCNIRPTLSYGDFGDVDLVVEAVVENPKVKEAVLAEVEGLLD
DNATLTSNTSTISIDRLAANLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDAAVAATVA
YARQMGKTPIVVNDCPGFLVNRVLFPYFGGFSQLVEQGADFERVDKVMEGFGWPMGPAYL
LDVVGMDTAVHAQSVMAEGFPDRMAQEARNGGKTAIQRMYDEDRLGQKNGKGFYRYEEDK
KGKPKKVSDEQAHALVDEGVDTRREFSDDEIVARMMVPLCMEAVRCLEDGIVATPAEADM
ALIYGIGFPPFRGGALRYIDALGVEAFVSQAEALADELGPLYRPTERLRDMAAKGERFYP
ATSESDH
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggtaacgccatcacggtggtgcagcgcgatgacggcatcgccacgctg
accttcgatgcgcaaggcgaatccgtcaacacgctctcgagcaagacgatcgaggagttc
gaggcggccctggcagccctcgaccaggcagcgggcgtcaagggcctggtcatcgccagc
gccaaggatgccttcatcgtcggggccgacatcaccgaatttcacggcatgttcacgcgc
gacgaagccttcctggtcgacatgaacacgcgcgtgcaccgtatcttcaataccctggag
gatctgccttatcccagcgtggcggcgatcaacggcctggcgctcgggggcggctgcgaa
atcaccctggcgtgcgatttccgcgtcatgagcgacaacgccaagctgggcctgcccgag
accaagctggggatcctgccgggctggggcggctgcgtgcgcctgccgcgcttgatcggg
gcggacaacgccatcgagtggatcgccggtggctcggaaaaccgcgccgacgacgccctc
aaggtcggcgcggtggatgccgtggtctcgggcgatgcgctgatgaatgcggccgtggac
ctgctgacgcgcgccaatgccggcgagctcgaccaccgggcacgtcgccgcctcaagcaa
tccccgctcatgctcaatgccatcgaacagatgatggtcttcgagaccgccaagggctac
gtggcgggcaaggccgggccgcactatccggcgcccatcgaggcgatcaaggtcatccag
aagggcgccggcgaggagcgcgagcgcgcgcaggccatcgaggccaaggccttcgccaag
ctcgccaagaccgatgtctgctaccacctggtggggctgttcctcaacgatcagctggtc
aagaagaaaggcaagcagtacgccatgcaagccgcggccgtgaacaagacggcggtgctg
ggggccggcatcatgggcggcggcatcgcctaccagagcgcctacaagggcactccgatc
ctgatgaaggacatcaaggaagaggcgctgcagctgggcctgaaggaagcgcgcaagctg
ctcggcaagcagctcgagcgcggtcgattgagcaatgagcaggtcgccgaggcgctctgc
aacattcgccccacgctgtcctacggggacttcggcgatgtcgatctggtggtcgaggcc
gtggtcgagaacccgaaggtcaaggaggccgtgctggccgaggtcgagggactgctcgac
gacaatgccacgctgacctcgaacacctcgacgatctccatcgaccggctggcggccaac
ctcaagcgtcccgagaacttctgcggcatgcacttcttcaaccccgtgcatcgcatgccg
ctggtcgaggtcattcgcggcgagaagaccagcgacgccgccgtggccgcgactgtggcg
tacgcccgtcagatgggcaagacccctatcgtggtcaacgactgcccgggtttcctggtc
aatcgcgtgctgtttccctatttcggcggcttcagccagctggtcgagcagggcgcggac
ttcgagcgcgtcgacaaggtcatggaaggcttcggctggccgatgggcccggcctatctg
ctggatgtcgtgggcatggacaccgccgtgcacgcccagtcggtgatggcggaaggcttt
cccgatcgcatggcgcaggaagccagaaacggtggcaagacggcgattcagcgcatgtac
gacgaggaccgcctgggccagaagaacggcaaggggttctaccgctacgaggaggacaag
aagggcaagcccaagaaagtctccgatgagcaggcgcatgcgctggtcgatgaaggcgtc
gacacgcgccgcgagttcagtgacgacgagatcgtcgcgcgcatgatggtgccgctgtgc
atggaggccgtgcgctgcctggaagacggcatcgtggcgacgcccgccgaggcggacatg
gcgctgatctacggcatcggcttcccgccgttccggggtggggcgctgcgctacatcgac
gccctgggcgtcgaggcgttcgtttcccaggccgaggcgctggccgacgagctggggccg
ctgtatcgccccaccgagcggctgcgcgacatggcggccaagggggaacgtttctacccc
gcgacgtccgaatccgaccactga

DBGET integrated database retrieval system