KEGG   Chromohalobacter salexigens: Csal_2449Help
Entry
Csal_2449         CDS       T00347                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00630  Glyoxylate and dicarboxylate metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Csal_2449
Enzymes [BR:csa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Csal_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABE59796
UniProt: Q1QUR2
Position
2754022..2755332
Genome map
AA seq 436 aa AA seqDB search
MSQTREQQIAALEKDWNENPRWKDVKRPYSAEDVVRLRGSVNEAHTLASRGAEKLWRLVN
GEARKGYVNCLGALTGGQAMQQVKAGIEAIYLSGWQVAADNNSYLSMYPDQSLYPVDSVP
KVVERINNSFRRADQIQWQKGANPGDADFVDYFAPIVADAEAGFGGVLNAYELMTAMIRA
GASGVHFEDQLAAVKKCGHMGGKVLVPTQEAVQKLVAARLAADVAGTPTLVIARTDANAA
NLITADVDDYDKPFITGERTAEGFYRVNAGLDQAISRGLAYAPFADIIWCETAKPDLDEA
RRFAEAIHREYPGQLLAYNCSPSFNWKKNLDDAEIAGFQQALADMGYTYQFITLAGIHNM
WYNMFDLAHSYAQGEGMKHYVEKVQQPEFEAAERGYTFVAHQQEVGTGYFDDMTNVIQGG
VSSVTALKGSTEEAQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagacacgcgaacagcaaatcgctgcgttggaaaaggattggaacgagaatccg
cgctggaaggacgtcaagcgtccgtacagtgccgaagatgtggttcgacttcgcggcagc
gtcaacgaagcgcacacgctggccagccgcggcgccgagaagctctggcgactggtcaat
ggcgaggcccgcaagggctacgtcaactgcctcggcgcgctgaccggcggccaggccatg
cagcaggtcaaggcaggtatcgaggcgatctatctctcgggctggcaggtcgccgccgac
aacaacagctacctgtcgatgtatcccgaccagtcgctctatccggtggactcggtgccc
aaggtcgtcgaacgcatcaacaacagtttccgccgcgcggatcagatccagtggcagaag
ggcgccaaccccggcgatgccgacttcgtcgattacttcgcccccatcgtcgccgacgcc
gaggcgggattcggcggcgtgctcaacgcctatgaactgatgacggcaatgatccgtgcc
ggtgccagtggcgtgcatttcgaggatcagctcgccgcggtcaagaagtgcggccacatg
ggcggcaaggtgctggtgcccacgcaggaggccgtgcagaagctggtcgccgcccgtctg
gccgccgacgtcgcgggcacgccgacgctggtcatcgcgcgcaccgacgccaatgccgcc
aacctgatcaccgccgacgtggatgattacgacaagcccttcatcaccggggaacgcacc
gccgaaggcttctatcgggtcaatgccggcctcgatcaggccatctcgcgaggcctggcc
tacgcgcccttcgccgacatcatctggtgcgaaaccgccaagccggatctcgacgaagcc
aggcgcttcgccgaggcgatccatcgcgaatatccggggcaactgctcgcctacaactgc
tcgccgtccttcaactggaagaagaacctcgacgatgccgagatcgccgggttccagcag
gccctggccgacatgggctacacctaccagttcatcaccttagcgggcattcacaacatg
tggtacaacatgttcgatctcgcccacagctacgctcagggcgaaggcatgaagcactac
gtcgagaaggtccagcagccggaattcgaggccgccgaacgcggctacaccttcgtcgct
caccagcaggaagtgggcaccggctacttcgacgacatgaccaacgtcatccagggcgga
gtgtcgtcggtgaccgccctcaagggctccaccgaggaagcgcagttctga

DBGET integrated database retrieval system