KEGG   Chromohalobacter salexigens: Csal_2579Help
Entry
Csal_2579         CDS       T00347                                 

Definition
(GenBank) Malate dehydrogenase (acceptor)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00020  Citrate cycle (TCA cycle)
csa00620  Pyruvate metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01130  Biosynthesis of antibiotics
csa01200  Carbon metabolism
Module
csa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Csal_2579
   00620 Pyruvate metabolism
    Csal_2579
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Csal_2579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABE59926
UniProt: Q1QUD2
Position
2892376..2893902
Genome map
AA seq 508 aa AA seqDB search
MVGTHMDESVDIVLVGAGVMSATLATLLHELEPDARIEIIERLDSTASESSFAWNNAGTG
HAGLCELNYTPRADDGSISLDKAIHTNTLFEESKQFWSYLVEKGNLGDPGRFVHPVPHMS
FVRGEDDVRFLRDRYHAMREHPCFEGMEYTEDRSVIGQWAPLLLDGREGDEPLAATRVAT
GTDVDFGALTRQLLARLEEKPDEQVRITTGQTVEDLTRNEDGSWRIKIAGNDDTQRTLNA
RFVFLGAGGASLHLLQKSGIPEGKGYAGFPVSGQWLRCDKPEIVSRHNAKVYSKAPIGAP
PMSVPHLDTRNVDGSPSLLFGPFAGFTTKFLKTGSVMDLAKSVRSSNLSPMLSVARDNFS
LVKYLIDQVRLSHEQRVDELRTFYPMAKNDDWRLEVAGQRVQVIKKDPQKGGILQFGTEV
VAASDGSLAALLGASPGASTATSIMLNLVEQCFPEKFASQAWQQRLHDLVPARAETLADN
GDLLRDVRRRTHDTLKLVDTQPSPEPVT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggttggcacgcatatggatgagtcagtagacattgtactcgtgggcgcgggcgtcatg
agcgccacgctcgcgaccctgcttcacgagctggaaccggatgcccgcatcgagatcatc
gagcgtctcgacagcaccgccagcgaaagctcatttgcctggaacaatgccggcaccggt
cacgccggcttgtgcgaactcaactacacgccccgcgccgacgacggctcgatctcgctc
gacaaggccattcataccaacaccctgttcgaagagtccaagcagttctggagctacctg
gtcgagaaaggcaatctcggcgaccccggccgtttcgtgcatcccgttccgcacatgagc
ttcgtgcgcggcgaggacgacgtgcgcttcctgcgcgatcgctaccacgccatgcgcgag
catccctgtttcgaaggcatggaatacaccgaggatcgcagcgtcatcggccagtgggcg
ccgctgctgctcgacggtcgcgaaggcgatgaaccgctcgcggcgacacgcgtggccacc
ggcaccgatgtcgatttcggcgcgctgacccgccaattgctcgctcgcctcgaggaaaaa
cccgacgagcaggtacgcatcactaccggccagacggtcgaggacttgacgcgcaatgaa
gacggcagctggcgcatcaagatcgcgggcaacgacgacacccagcgcaccctgaacgca
cgcttcgtgttcctgggcgccggcggcgcctcgctgcatcttctgcagaagagcggcatt
cccgaaggcaagggctacgcgggcttcccggtcagtggccaatggctgcgctgcgacaag
cccgagatcgtctcgcgccacaatgccaaggtctacagcaaggcgcccatcggcgcgcct
cccatgtcggtgccgcatctcgacacacgcaacgtcgatggctcgccctcgctgctgttc
ggccccttcgccggcttcaccaccaagttcctgaagaccggctcggtgatggatctggcc
aagtccgtgcgctcctccaacctgagccccatgctctcggtggcgcgtgacaacttcagc
ctggtcaagtacctgatcgatcaggtacggctgtcgcacgagcaacgtgtcgacgagctg
cgcacgttctatcccatggccaagaatgacgactggcgcctcgaagtcgccggtcagcgc
gtccaggtgatcaagaaggacccgcagaaaggcggcatcctgcagttcggcaccgaggtc
gtggccgccagtgacggctcgctggcggcactgctgggcgcctcgcccggcgcctccacc
gccacctcgatcatgctcaatctcgtcgaacagtgcttccccgagaagttcgccagccag
gcatggcagcagcgcctgcacgatctcgtgcccgctcgtgccgagaccctggccgacaac
ggcgacctgctgcgcgacgtgcgccgccgcacgcacgacaccctcaagctggtggacacg
cagcccagtcccgaaccggtgacctga

DBGET integrated database retrieval system