KEGG   Chromohalobacter salexigens: Csal_2841Help
Entry
Csal_2841         CDS       T00347                                 

Definition
(GenBank) permease for cytosine/purines, uracil, thiamine, allantoin
Organism
csa  Chromohalobacter salexigens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-ProteinID: ABE60187
UniProt: Q1QTM1
Position
3172496..3173830
Genome map
AA seq 444 aa AA seqDB search
MAFFHRLLGQDTLDDHQHKSLGAFGTVALWLGANVVVTTILTGMLLVPDLPFTTAMGSVL
IGSLIGAIPLLLVGLMGQRTGLPSMALTRRAYGPLGSRLISLVNMGVLIAWSWIQALLAG
MSLDYAIQATTGYSNLPLMTILCETVVVLIVLRGHLGIERVERWAAMAMVALAAVVLYQL
NLHYDVSTLLDMPVEARNGITLGIAFDIVIATAFSWISSSADYNRNCKSGAIAVWGTYLG
YVMAAMIAMGLGAAVSGLSVMNGMEQTYDPTRLLSGFGFGLPAALVIFFSVMTTNVMAVY
SATLSCMNVSPGMAFWKPALIIGIVTVFGALIPGILDQFQNFLLLIGALFIPAFSVIIVD
YYLVGREGYSPELLKARHQLGRPTAPVAIGAYVIGAGLAAYWSLVAPLAFGASLPVFIIT
GGLYWLGAMLLTKSRANASQTAGE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctttcttccatcgtctgctcggtcaggacaccctcgacgaccaccagcacaagagc
ctcggggcgttcggcactgtcgccctgtggctcggcgccaacgtcgtggtcaccaccatc
ctcaccggcatgctcctggtgcccgatctgcccttcacgaccgccatgggcagcgtgctg
atcggctcgttgatcggcgccatcccgctcctgctggtcgggctgatgggccagcgcacc
ggcctgccttccatggcgttgacccggcgcgcgtatggcccgctcggcagccggctgatc
tcgctggtcaacatgggggtactgatcgcctggagctggatccaggccctgctcgccggc
atgagtctcgactacgccatccaggcgaccaccggctactccaacctgcccttgatgacc
atcctctgcgagaccgtggtggtcctcatcgtgctgcgtggccacctgggcatcgagcgg
gtcgaacgctgggcggcgatggccatggtggcgctggccgccgtggtgctctaccagctg
aacctccactacgatgtctcgaccctgctggacatgccggtcgaggcccgtaacggcatc
accctgggcatcgccttcgacatcgtcatcgccaccgccttctcctggatctcgtcctcg
gcggattacaatcgcaactgcaagagcggcgccatcgccgtctggggcacctaccttggc
tacgtgatggccgccatgatcgccatgggcctgggtgccgccgtttccgggctgtcggtc
atgaacggcatggagcagacctacgacccgacccggctgctctccggtttcggcttcggc
ctgcccgcggccctggtcatcttcttctccgtgatgaccaccaatgtcatggccgtctac
agcgccaccctgtcctgcatgaacgtgtcgcccggcatggccttctggaaaccggcgctg
atcatcgggatcgtgaccgtcttcggcgccctgattcccggcatcctggaccagttccag
aactttctgctattgataggcgcgctgttcatcccggccttctcggtgatcatcgtcgat
tactacctggtcggtcgcgagggttacagccccgaactgctcaaggcgcgtcaccagctg
ggacgccccaccgcgccggtggccatcggtgcctacgtgatcggcgccgggctagccgcc
tactggtcgctggtcgcgccgctggccttcggcgcctcgctgccggtcttcatcatcacc
ggcggcctctactggctcggcgccatgctgttgacaaagtcccgcgccaacgcttcacag
accgcaggagagtga

DBGET integrated database retrieval system