KEGG   Chromohalobacter salexigens: Csal_3154Help
Entry
Csal_3154         CDS       T00347                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00620  Pyruvate metabolism
csa00630  Glyoxylate and dicarboxylate metabolism
csa01100  Metabolic pathways
csa01110  Biosynthesis of secondary metabolites
csa01120  Microbial metabolism in diverse environments
csa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Csal_3154
   00630 Glyoxylate and dicarboxylate metabolism
    Csal_3154
Enzymes [BR:csa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Csal_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABE60498
UniProt: Q1QSR0
Position
complement(3518134..3520362)
Genome map
AA seq 742 aa AA seqDB search
MTDRTTRHRLQVASQLDRFINDEALPGTGVDPEAFWAGFDALVHELVPTNRDLLAERERL
QDELDAWHKANPGPVRDMAAYRAFLKDIGYLVEAPAKVQATTANVDDEIAVQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDVIPETDGAEKSQGYNPKRGEKVIAYARGVLDQAA
PLAEGTHAEASAYALRDGKLVVTLQGGGETGLADPAQLVGYRGEAQAPTAVLLANHGLHL
EVQFDATHPIGKTDPAHVKDVLVEAAVSTIMDCEDSVAAVDADDKTLVYRNWLGLMKGDL
EERFDKGGKTVTRALNPDRDYTVPGGGELRLPGRSLLFVRNVGHLMTTPAVLDGDGNEIP
EGMLDGVVTSLLAIHDLKKGDGAAPSATAPEAKRNSRTGSVYIVKPKMHGPREVAFANSL
FMRIEDMLGLPRDTLKMGIMDEERRTSINLDACIHEAASRVAFINTGFLDRTGDEMHTAM
EAGPMLRKGEMKGTKWIAAYEKNNVQTGLACGLRGRAQIGKGMWAMPELMAAMLEQKIGH
PQAGATTAWVPSPTAAVLHALHYHQVDVATIQRELEAKPGGDFLDDLLTVPVVESAASGA
NKSPSWSDDEIQQELDNNCQGILGYVVRWVEHGVGCSKVPDIHDVGLMEDRATLRISSQH
IANWLHHGIVSEARVRETLERMAKVVDDQNAHDPDYTPMTSHLAESCAFQAASDLIFKGR
EQPAGYTEPLLHHWRAVHKAKS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccgtacgacacgccatcgtttgcaggtggccagccagctcgaccgtttcatc
aacgacgaagcgttgccgggaacgggcgtcgaccccgaggccttctgggccgggttcgat
gccctggtccacgagctcgtgcccaccaatcgtgacctgctggccgagcgcgagcgactg
caggacgaactggacgcctggcacaaggcgaaccccgggccggtgcgggacatggccgcc
tatcgtgccttcctgaaggacatcggttatctggtcgaggcgccggccaaggtgcaggcc
accaccgccaatgtcgatgacgagatcgccgtgcaggcggggccccagctggtggtgccg
gtaagcaacgcgcgttatgccctcaatgccgccaatgcgcgctggggcagcctttacgac
gcgctctacggcaccgacgtgattcccgagacggacggcgccgaaaaaagccagggctac
aaccccaagcgtggcgaaaaggtcatcgcctacgcacgcggtgtgctcgaccaggcagcc
cccctggccgagggcacgcatgccgaggcgagcgcttatgctctgcgtgacggcaagctg
gtggtgaccctgcagggcggcggtgagacggggctggccgatcctgcgcaactggtcggt
taccgaggcgaggcacaggcgcccacggcggtgctgctcgccaatcatggcctgcatctg
gaagtccagttcgacgccactcaccccatcggcaagaccgatccggcccacgtcaaggac
gtgctggtcgaggcggcggtgagcaccatcatggactgcgaggactccgtggcggccgtg
gacgccgacgacaagacgctggtctatcgcaactggctggggctgatgaagggcgacctc
gaggagcgcttcgacaagggcggcaagacggtgacgcgcgccctcaacccggaccgcgac
tacacggtccccggcggtggcgagttgcgcctgcccggacgctctttgctgttcgtgcgc
aatgtcggccatctgatgaccacgccggccgtgctcgatggcgatggcaacgagattccc
gagggaatgctggatggcgtggtcaccagtctgctggcgattcacgacctcaagaaaggc
gacggcgctgccccgtccgccacggcaccggaggccaagcgtaatagccggacgggatcg
gtctatatcgtcaagcccaagatgcacggccccagggaagtggccttcgccaacagcctg
ttcatgcgcatcgaggacatgctgggcctgccgcgcgataccctcaagatgggcatcatg
gacgaggagcggcgtacctcgatcaacctcgatgcgtgcattcacgaggcggcgtcccgc
gtggcgttcatcaacaccggcttcctcgaccgtaccggcgacgagatgcacaccgccatg
gaagccggccccatgctgcgcaagggggagatgaagggcaccaagtggatcgcggcctac
gaaaagaacaatgtccagaccggcttggcgtgcggcctgcgcggccgggcgcagatcggc
aagggcatgtgggccatgccggagctgatggcagcgatgctcgagcagaagatcggccat
ccccaggccggtgcgaccacggcctgggtgccgtcacccaccgccgccgtgctgcatgcc
ctgcactaccatcaggtcgatgtcgcgacgattcagcgtgaactggaggccaagcccggt
ggcgactttctcgacgatctgctcaccgtgccggtggtcgaaagcgcggcttcgggcgct
aacaagagcccgagctggtccgacgacgagattcagcaggagctggataacaactgtcag
ggcatcctcggctatgtggtgcgctgggtcgagcatggcgtgggctgctccaaggtgccg
gacatccacgacgtggggctgatggaggatcgcgcgacgttgcgtatctccagtcagcac
atcgccaactggctgcatcatggcatcgtcagcgaggcacgggtacgcgagacgctggag
cgcatggccaaggtggtcgacgaccagaatgcccacgatcccgactatacgccgatgacc
tcgcacctggcggagtcctgcgcctttcaggcggcatccgacctgatcttcaaggggcgt
gagcagcccgccggctacaccgagccgctgctgcaccactggcgcgcggtgcacaaggcg
aaatcataa

DBGET integrated database retrieval system