KEGG   Chlorocebus sabaeus (green monkey): 103214398Help
Entry
103214398         CDS       T04361                                 

Gene name
SUCLA2
Definition
(RefSeq) succinate-CoA ligase ADP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00020  Citrate cycle (TCA cycle)
csab00640  Propanoate metabolism
csab01100  Metabolic pathways
csab01200  Carbon metabolism
Module
csab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103214398 (SUCLA2)
   00640 Propanoate metabolism
    103214398 (SUCLA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csab04147]
    103214398 (SUCLA2)
Enzymes [BR:csab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103214398 (SUCLA2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103214398 (SUCLA2)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103214398 (SUCLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-GeneID: 103214398
NCBI-ProteinID: XP_007958565
Position
3
AA seq 463 aa AA seqDB search
MAASVFYGRLLAVATLRNHRPRTALGAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMS
MELLQEAGVSIPKGCVAKSPDEAYAVAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVK
IVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGP
VLIGSSHGGVNIEDVAAETPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENM
VKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDER
DKDAAQANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVTEA
FKLITSDKKVLAILVNIFGGIMRCDVIAQGIVTALKDLEIKIPVVVRLQGTRVDDAKALI
AGSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLPI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgtgttctacggccggctgctggctgtagctacccttcggaaccacagg
cctcggacagctctgggggccgctgctcaggtcctgggaagttctggattgtttaataac
catggactccaagtacagcagcaacagcaaaggaatctctcactacatgaatacatgagt
atggaattattacaagaagctggtgtctccattcccaaaggatgtgtggcaaagtcacca
gatgaagcttatgcagttgccaaaaaattaggttcaaaagatgttgtgataaaggcgcag
gtcttagctggtggtagaggaaaaggaacgtttgaaagtggcctcaaaggaggagtgaag
atagttttctctccagaagaagcaaaagctgtttcttcacaaatgattgggaaaaaattg
tttaccaagcaaacgggagaaaagggcagaatatgcaatcaagtattggtctgtgagcgg
aaatatcccaggagagaatactactttgcaataacaatggaaaggtcatttcaaggtccc
gtattaataggaagttcacatggtggtgtcaacattgaagacgttgctgctgagactcct
gaagcaataattaaagaacctattgatattgaagaaggcatcaaaaaggaacaagctctc
cagcttgcacagaagatgggatttccacctaatattgtggaatcagcggcagaaaacatg
gtcaagctttacagcctttttctgaaatatgatgcaaccatgatagaaataaatccaatg
gtggaagattcagatggagctgtattgtgtatggatgcaaagatcaattttgactctaat
tcagcctatcgccaaaagaaaatctttgatctacaggactggacccaggaagatgaaagg
gacaaagacgctgctcaggcaaatctcaactacattggcctcgatggaaatataggctgc
ctagttaatggtgctggtttggctatggccacaatggatataataaaacttcatggaggg
actccagccaacttccttgatgttggtggtggtgctacagtccatcaagtaacagaagca
tttaagcttatcacttcagataaaaaggtactggctattctggtcaacatatttggagga
atcatgcgctgtgatgttattgcacagggtatagtcacggcactaaaagatttggaaatt
aaaatacctgttgtggtacggttacaaggtacacgagtcgatgatgctaaggcactgata
gcaggaagtggacttaaaatacttgcttgtgatgacttggatgaagctgctagaatggtt
gtaaagctctctgaaatagtgaccttagcgaagcaagcgcatgtggatgtgaaatttcag
ttgccaatatga

DBGET integrated database retrieval system