KEGG   Chlorocebus sabaeus (green monkey): 103216530Help
Entry
103216530         CDS       T04361                                 

Gene name
ZDHHC6
Definition
(RefSeq) zinc finger DHHC-type containing 6
  KO
K20031  palmitoyltransferase ZDHHC6 [EC:2.3.1.225]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csab04131]
    103216530 (ZDHHC6)
Enzymes [BR:csab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103216530 (ZDHHC6)
Membrane trafficking [BR:csab04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    103216530 (ZDHHC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC SH3_2
Motif
Other DBs
NCBI-GeneID: 103216530
NCBI-ProteinID: XP_007962303
Ensembl: ENSCSAG00000005132
UniProt: A0A0D9QYL5
Position
9
AA seq 413 aa AA seqDB search
MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIM
LINWTVMILYNYFNAMFVGPGFVPLRWKPEISQDTMYLQYCKVCQAYKAPRSHHCRKCNR
CVMKMDHHCPWINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYNRLSFGWNT
VKIDMSAARRDPLPIVPFGLAAFATTLFALGLALGTTIAVGMLFFIQMKIILKNKTSIES
WIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSGVPEGDGLEWPVREGCHQYSL
TIEQLKQKADKRVRSVRYKVIEDYSGACCPLNKGIKTFFTSPCTEEPRIRLQKGEFILAT
RGLRYWLYGDKILDDSFIEGVSRIRGWFPRKCVEKCPCDAETDQAPEGEKKNR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgggtacattctgttcagttatcaagtttgaaaatctccaagaattaaagagactgtgt
cactggggtcccatcatagccctcggtgttatagcaatatgttctacaatggccatgatt
gactcagtgttgtggtattggcccttacatacaactggaggaagtgtgaatttcatcatg
ttgataaattggactgtcatgattctttataattatttcaatgccatgtttgtcggtccg
ggctttgtccctctgaggtggaaaccggaaatttctcaggataccatgtatctccagtat
tgtaaagtctgccaagcatacaaggcaccacgttcacatcactgcagaaagtgtaacaga
tgtgtgatgaagatggaccatcactgtccttggatcaacaactgttgtggttaccaaaat
catgcttcgttcacactgtttctccttttagcaccactgggttgtatccatgctgctttc
atttttgtgatgactatgtacacacagctttataatcggctctcctttgggtggaacaca
gtgaagattgacatgagtgcagcccggagagatcctcttccaattgttccatttggatta
gctgcatttgctaccaccttgtttgccttgggattagctttaggaacaaccatagctgtt
gggatgttgttttttatccagatgaaaataattctcaaaaacaaaacttctattgagtca
tggattgaagagaaggctaaagatcgaattcagtattatcaactagatgaagtctttgtt
tttccatatgatatgggaagtagatggaggaactttaaacaggtatttacgtggtcaggg
gtccctgaaggagatggacttgagtggccagtaagagaaggctgtcaccaatacagctta
acaatagaacagttgaaacaaaaagcagataagagagtcagaagtgttcgctataaagta
atagaagattatagtggtgcctgctgccctttgaataaaggaatcaaaaccttcttcaca
agcccctgcactgaagaaccgcgaatacggctacaaaaaggggaattcattttagccaca
agaggtttacgatactggttgtatggagacaaaatccttgatgattcctttatagaaggt
gtttcaagaataaggggatggttccctagaaaatgtgtggaaaagtgtccctgtgatgct
gaaacagatcaagccccagagggcgagaagaaaaatagatag

DBGET integrated database retrieval system