KEGG   Chlorocebus sabaeus (green monkey): 103217856Help
Entry
103217856         CDS       T04361                                 

Gene name
CXCR1
Definition
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04060  Cytokine-cytokine receptor interaction
csab04061  Viral protein interaction with cytokine and cytokine receptor
csab04062  Chemokine signaling pathway
csab04072  Phospholipase D signaling pathway
csab04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    103217856 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103217856 (CXCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103217856 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103217856 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103217856 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:csab04030]
    103217856 (CXCR1)
   04050 Cytokine receptors [BR:csab04050]
    103217856 (CXCR1)
   04090 CD molecules [BR:csab04090]
    103217856 (CXCR1)
G protein-coupled receptors [BR:csab04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    103217856 (CXCR1)
Cytokine receptors [BR:csab04050]
 Chemokine receptors
  CXC Chemokine
   103217856 (CXCR1)
CD molecules [BR:csab04090]
 Proteins
  103217856 (CXCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Cyclin_N
Motif
Other DBs
NCBI-GeneID: 103217856
NCBI-ProteinID: XP_007964429
Ensembl: ENSCSAG00000018775
Position
10
AA seq 351 aa AA seqDB search
MSNAIDPQMWGDDYDLNFTGMPPTGEDYSPCRLETEPLNKYVVIVTYALVFLLSLLGNSL
VMLVILYSRVSRSVTDVYLLNLAMADLLFALSLPIWAASKVNGWIFGTFLCKVVSLLKEV
NFYSGILLLACISVDRYLAIVHATRTLIQKRHLVKFVCLSCWGLSVILSLPFFLFRQAYH
PDNSSSVCYEVLGNDTAKWRMVLRILPHTFGFILPLLIMLFCYGFTLHTLFKAHIGQKHR
AMRVIFAVVLIFLLCWLPYHLVLLADTLMRTNLIKESCERRNDIDKALDATEILGFLHSC
LNPIIYAFIGQNFRHGFLKILATHGLVSKEFLARHHVTSYTSSSVNVSSNL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgctatagatccacagatgtggggtgatgactatgatctaaatttcactggc
atgccacctacaggtgaagattatagcccctgtaggctagagactgagccactcaacaag
tatgttgtgattgtcacctatgccctagtgttcctgctgagcctgctgggaaattctctc
gtgatgctggtcatcttatacagcagggtcagccgttccgtcactgatgtctacctgctg
aacctggccatggccgacctgctctttgccctgagcttgcccatctgggccgcctccaag
gtgaatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtc
aacttctacagtggcatcctgctactggcctgcatcagtgtggaccgttacctggccatt
gtccatgccacacgcacactgatccagaagcgtcacttggtcaaatttgtttgtctcagc
tgctggggactgtctgtgattctgtccctgcccttcttccttttccgccaggcttatcat
ccagacaactccagttcagtttgctatgaggtcctgggaaatgacacagcaaaatggcgg
atggtgttgcggatcctgcctcacacctttggcttcatcttgccgctgctgatcatgctg
ttctgctatggattcaccctgcatacgctgtttaaggcccacatagggcagaagcaccgg
gccatgcgggtcatctttgctgtcgtccttatcttcctgctctgctggctgccctaccac
ctggtcctgcttgcagacaccctcatgaggaccaacctgatcaaggagagctgtgagcgc
cgcaatgacattgacaaggccctggatgccaccgagattctgggatttctccatagttgc
ctcaaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatc
ctggccacacatggcctggtcagcaaggagttcttagcacgtcatcatgttacctcctac
acttcttcctctgtcaatgtctcttccaacctctga

DBGET integrated database retrieval system