KEGG   Chlorocebus sabaeus (green monkey): 103218360Help
Entry
103218360         CDS       T04361                                 

Gene name
WNK1
Definition
(RefSeq) WNK lysine deficient protein kinase 1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csab01001]
    103218360 (WNK1)
   01009 Protein phosphatases and associated proteins [BR:csab01009]
    103218360 (WNK1)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103218360 (WNK1)
Protein kinases [BR:csab01001]
 Serine/threonine kinases: Other
  Wnk family
   103218360 (WNK1)
Protein phosphatases and associated proteins [BR:csab01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103218360 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 103218360
NCBI-ProteinID: XP_007965301
Ensembl: ENSCSAG00000011929
Position
11
AA seq 2850 aa AA seqDB search
MSGGAAEKQSSTPGSLFLSPPAPVPKNGSSSDSSVGEKLGAAAADAGTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAVVPHSAPPEPH
REETVAATAASQVAQQPPAAAAPGEQAVAGPAPSTVPSSTGKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSNASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHVPSAVQAQSQPHGVYPPSSVPQSMAHP
CGGTPTYPESQIFFPTIHERPVSFSPPPTCPPKVAISQRRKSTSFLEAQTHHLPPLLRTV
GQSLLPPGGSPTHWTPEAVVMLGTTASRVTGESCEIQVHPMCEPSQVYSDYRPGLVLPEE
AHYFIPQEAVYLAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSSSVFEF
PSGQAFLVGHLQNLRLDSGLSPGSPLSSISAPISTDATRLKFHPVFVPHSAPAVLTHNNE
SRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQEELPPQSVGLHGYLQPVTE
EKHNYHAPELTVSVVEPIGQNWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAAASFGSD
VSLPFIHLPQTVLQESPLFFCFPQGTTSQQVLTASFSSGGSALHPQAQGQSQGQPSSSSL
TGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPASQPQAPQVLPQVS
AGKQLPVSQPVPTIQGEPQIPVATQPSAVPVHSGAHFLPVGQPLPTSLLPQYPVSQIPIS
APHVSAAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLLQPVTQLP
SQVHPQLLQPAVQSMGVPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNIAPSSNVA
SVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPGVSLAQAP
TTSSQQAVLESTQGVSQVAPPEPVPVAQPQPTQPATLASSIDSAHSDVASGMSDGNENVP
SSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETHNRKMVTF
KFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEPEGDQGLE
SLQGKDDYGFSGSQKLEGEFKQPIPVSSMPQQIGIPTSSLTQVVHSAGRRFIVSPVPESR
LRESKLFTSEITDTVAASTSQSPGMNLSHSASSLSLQQAFSELRHAQMTEGPNTAPPNFS
HTAPTFPVVPPFLSSVAGVPTTAAATVPVPATSSPPNGMSTSVIQSEVTVPTEEGIAGVA
TSTGVATSGGLHIPPVSESPVLSSVVSSTTIPAVVSISTTSPSLQVPTSTSENIVSSTAL
YPSVTVSATSASAGGSTVTPGPKPPAVMSPQAAGSTTVGVTLTSVSATTSLPSTASQLSI
QLSSSTSAPTLAETVVVSAHSLDKTSHSITTGLALSFSAPSSASSPGAGVSSSISQPGGL
HPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHSQPQPALL
PNQPHTHCPEIDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHAPVSLETSLVVEST
VTPGVPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVSTATSGVKP
GTAPSKPPLTKPPVLPVGTELPAGALPNEQLPPFPGPSLTQSQQPLEDLDAQLRRTLSPE
IITVTSAVGPVSVVAPTAVTEAGAQPQKDVSQVTEKGPVLATSSGAGVFKMGRFQVSVAA
DDTQKEGKSKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGISIPGISSDVPESAH
KTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSVSKTEDKITDTKKEGPVASPPFMDLEQ
AVLPAVIPKKEKPELSEPSHLNGPSSDLEAAFLSRDVDDGSGSPHSPHQLSSKSLPIQNL
SQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIESLYTKLG
KVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASVLHPQQT
LHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGCAKFNCASEQV
TFKPGGRRTRFLSTPCLALWKMVKKVCPCNQLCMCPPAEPKSGTSSTNTVGATVNSQAAQ
AQPPAMTSSRKGTFTDDLHKLVDNWARDAMILSGRRGSKGHMNYEGPGMARKFSAPGQLC
ISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGTGGPAPQPIGQFQ
PVGTASLQNFNISNLQKSISNPPGSNLRTT
NT seq 8553 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggcgccgcggagaagcagagcagcactcccggctccctgttcctctcgccg
ccggctcctgtccccaagaatggctccagctccgattcctccgtgggggagaagctgggg
gccgcggccgccgacgcggggaccggcaggacggaggagtaccggcgccgccgccacacg
atggacaaggacagccgcggggcggccgcgaccaccaccaccacggagcaccgcttcttc
cgccggagtgtcatctgcgactccaatgccactgcgctggagctccccggcctccctctt
tccctcccccagcccagcatccccgcggttgtcccgcacagtgccccaccggagccccac
cgggaagagaccgtggccgccaccgccgcctctcaggtagcccagcagcctccagccgct
gccgcccctggggaacaggcggtcgcgggccctgccccctcgactgtccccagcagtacc
ggcaaagaccgcccagtgtcccagcctagccttgtggggagcaaagaggagccgccgcca
gcgagaagtggcagcggcggcggcagcgccaaggagccgcaggaggaacggagccagcag
caggatgatatcgaagagctggagaccaaggccgtgggaatgtctaacgacggccgcttt
ctcaagtttgacatcgaaatcggcagaggctcctttaagacggtctacaaaggtctggac
actgaaaccactgtggaggtcgcctggtgtgaactgcaggatcgaaaattaacaaagtct
gagaggcagagatttaaagaagaagctgaaatgttaaagggtcttcagcatcccaatatt
gttagattttatgattcctgggaatccacagtaaaaggaaagaagtgcattgttttggtg
actgaacttatgacgtctggaacacttaaaacgtatctgaaaaggtttaaagtgatgaag
atcaaagttctaagaagctggtgccgtcagatccttaaaggacttcagtttcttcatact
cgaactccacctattattcaccgcgatcttaaatgtgacaacatctttatcacgggccct
actggctccgttaagattggagaccttggtctggcaaccctgaagcgggcttcctttgcc
aagagtgtgataggtaccccagagttcatggcccctgagatgtatgaggagaaatatgat
gaatccgttgacgtttatgcttttgggatgtgcatgcttgagatggctacatctgaatat
ccttactcggagtgccagaatgctgcgcagatctaccgtcgcgtgaccagtggggtgaag
ccagccagttttgacaaagtagcaattcctgaagtgaaggaaattattgaaggatgcata
cgacaaaacaaagatgaaagatattccatcaaagaccttttgaatcatgccttcttccaa
gaggaaacaggagtacgggtagaattagcagaagaagatgatggagaaaaaatagccata
aaattatggctacgtattgaagatattaagaaattaaagggaaaatacaaagacaatgaa
gctattgagttttcttttgatttagagagagatgtcccagaagatgttgctcaagaaatg
gtagagtctgggtatgtctgtgaaggtgatcacaagaccatggctaaagctatcaaagac
agagtatcattaattaagagaaaacgagagcagcggcagttggtacgggaggagcaagaa
aaaaaaaagcaggaagagagcagtctcaaacagcaggtagaacaatcgaatgcttcccag
acaggaatcaagcagctcccttctgctagcaccggcatacctactgcttctaccacttca
gcttcagtttctacccaagtagaacctgaagaacccgaggcagatcaacatcaacagcta
cagtaccagcaacccagtatatctgtgttatctgatgggacggttgacagtggtcaggga
tcctctgtcttcacagaatctcgtgtgagcagccagcagacagtttcatatggttcccaa
catgaacaggcacattctacaggcacagtcccagggcatgtaccttctgctgtccaagca
caatctcagccccatggggtatatccaccctcaagtgtgcctcagtccatggcgcatccg
tgtggggggaccccaacatacccagaatcacagatatttttcccaactattcatgaacgt
ccagtttctttctcaccacctcccacctgcccaccgaaagtagccatttcccagcggcgt
aagagcacctccttcctggaagcccaaactcaccacctcccacccctgctgaggactgtc
ggccagagtcttcttccgcctggtggcagcccaactcactggacaccagaggctgtagtt
atgctgggtactacagccagtagagtaactggagagtcatgtgagatacaggtccatcct
atgtgtgaaccatctcaagtttacagtgactatagacctggactagtacttccagaagaa
gctcactattttattcctcaggaagcagtgtatctagctggggtacattaccaggcccgg
gtggcagaacagtatgagggcattccatacaactcatcagtactgtcaagtcctatgaaa
cagatacctgaacagaagccagtacaagggggccctacttcaagttctgtctttgaattt
ccatctggacaggctttcctggtaggacaccttcagaatctaagattagattctggattg
agtccaggatctcccctctctagtatttctgcacctatcagtacagatgctacacgtttg
aaatttcaccctgtctttgttcctcattctgcgcccgctgtgttaactcataacaatgag
agcagaagcaactgtgtatttgaatttcatgttcacacaccaagctcctcttcaggagaa
ggaggtggaattttacctcagcgtgtttaccgaaatcggcaggttgcagtggacttgaat
caagaagaactgcctcctcaatcagttggattacatggctacctgcagcctgtgactgaa
gaaaagcataattaccatgccccagaattgaccgtttctgtggtagagcctatcggacag
aactggccaataggaagcccagaatattccagtgattcctcacaaatcacttcttcagac
cccagtgattttcagtcacctccccctacagggggagcagctgcatcttttggctctgac
gtctcattaccctttatccatctgcctcagacagtgttacaagaatccccacttttcttc
tgtttcccccaaggaaccacatctcagcaggtcttaactgcctcattttcttcaggagga
tctgcacttcatccacaggcacaggggcagagccagggtcagccatcctcaagtagctta
acaggggtttcatcttcccaacccatacaacatcctcagcagcagcagggaatacagcag
acagctcctcctcaacagacagtgcagtattcactttcacagacatcaacctccagtgag
gccactactgcacagccagcgagtcaacctcaagctccacaagtcttgcctcaagtatca
gctggaaaacagcttccagtttcccagccagtaccaactatccaaggcgaacctcagatc
ccagttgcgacacaaccctcagctgttccagtccactctggtgctcatttccttccagtg
ggacagccgctccctacttccttgctccctcagtaccctgtctctcaaattcccatatca
gctcctcatgtgtctgcggctcagacaggtttctcatcccttcccatcacgatggcagct
ggcattactcagcctctgctcacgttggcttcatctgctacaacagctgcgatcccgggg
gtatcaactgtggttcctagtcagcttccaacccttctgcagcctgtgactcagctgcca
agtcaggttcacccacagctcctacaaccagcagttcagtccatgggagtaccagctaac
cttggacaagctgctgaggttccgctttcctctggagatgttctgtaccagggtttccca
cctcgactgccaccacagtacccaggagattcaaatattgctccctcttccaacgtggct
tctgtttgcatccattctacagtcctatcccctcccatgccgacagaagtactggctaca
cctgggtactttcccacggtggtgcagccttacgtggaatcaaatcttttagttcctatg
ggtggtgtaggaggacaggttcaagtgtcccagccaggagtgagtttagcacaagccccc
actacatcctcccagcaagcagttttggagagtactcagggagtctctcaggttgctcct
ccagagccagttccagtagcacagccacagcctacccagccggccacgttggcttcctct
atagacagtgcacattcagatgttgcttcaggtatgagtgatggcaatgagaacgtccca
tcttccagtggaagacacgaaggaagaactacaaaacggcattaccgaaaatctgtaagg
agtcgttctcgacatgaaaaaacttcacgcccaaaattaagaattttaaatgtttcaaat
aaaggagaccgagtggtagaatgtcaattagagactcataataggaaaatggttacattc
aaatttgacctagatggtgacaaccctgaggagatagcaacaattatggtgaacaatgac
tttattctagcaatagagagagagtcatttgtggatcaagtacgagaaattattgaaaaa
gctgatgaaatgctcagtgaggatgtcagtgtggaaccagagggtgaccaggggttggag
agtctacagggaaaggatgactatggcttttcaggttctcagaaattggaaggagagttc
aaacaaccaattcctgtgtcttccatgccacagcaaataggcattcctaccagttcttta
actcaagttgttcattctgctggaagacggtttatagtgagtcctgtgccagaaagtcga
ttacgagaatcaaaacttttcaccagtgaaataacagatacagttgctgcctctacatct
cagagccctggaatgaacttgtctcactctgcatcatcccttagtctacaacaggccttt
tctgaacttagacatgcccaaatgacagaaggacccaatacagcacctccaaactttagt
catacagcaccaacatttccagtagtacctcctttcttaagtagcgttgctggagtccca
accacagcagcagccacagtgccagtccctgccacaagcagccctcctaatggcatgtcc
acatcagtaattcagtctgaggttacggtgcccactgaagaggggattgctggagttgcc
accagcacgggtgtggcaacttcaggtggtctccacataccacctgtgtctgaatcacca
gtactttccagtgtagtttcaagtaccacaatacctgcagttgtctcaatatctactact
tccccatcacttcaagtccccacatccacatcggagaacattgtttctagtacagcactg
tatccttcagtaacagtttcagcaacttcagcttccgcagggggcagcactgtgacccca
ggtcctaagcctccagccgtcatgtctccgcaggcagcaggcagcactactgtgggagtc
acattaacatcagtttccgccaccacttcactgccaagcacagcttcacagctgtccatt
cagcttagcagcagtacttctgctcctactttagctgagaccgttgtagttagtgcacac
tcactagataagacatctcacagcattacaactggattggctttgtccttctctgcacca
tcttccgcttcctctcctggagcgggagtgtctagttctatttctcagcctggtgggctg
catcctttggtcattccatcagtgatagcttctactcccattcttccccaagcagcagga
cctacttctacacctttattaccccaagtacctagtatcccacccttggtacagcctgtt
gccaatgtgcctgctgtacagcagacactaattcatagtcagcctcaaccagctttgctt
cccaaccagccccatactcattgtcctgaaatagattctgatacacaacccaaagctcct
gggatcgatgacataaagactctagaagaaaagctgcggtctctcttcagtgaacacagc
tcatctggagctcagcatgcccctgtgtcactggagacctcactagttgtagagagcact
gtcacaccaggcgtcccaactactgctgttgcaccaagcaaactcctgacttctaccaca
agtacttgcttaccaccaaccaatttgccactaggaacagttgctttgccagttacacca
gtggtcacacctgggcaagtttctaccccagtcagcactgctacatcaggagtgaaacct
ggaactgctccctcaaaaccacctttaactaagcctccggtgctgccagtgggtactgaa
cttccagcaggtgctttacccaacgagcagctgccaccttttccaggaccttctctaacc
cagtcccagcaacctctagaggatcttgatgctcaattgagaagaacacttagtccagag
attatcacagtgacttctgcagttggtcctgtgtccgtggtggctccaacagcagttaca
gaagcaggagcacagcctcagaaggatgtttctcaagtcacagaaaaaggccctgtccta
gcaactagttcaggagctggtgtttttaagatgggacgatttcaggtttcagttgcagca
gatgatacccagaaagagggtaaaagtaagtcagaagatgcaaagtctgttcattttgaa
tccagcacttcagagtcctcggtgttgtcgagtagtagtccagagagtaccttggtgaaa
ccagagccgaatgggataagcatccctggtatctcttcagatgtgccagagagtgcccac
aaaactactgcctcagaggcaaagtcagacactgggcagcctaccaaggttggacgtttt
caggtgacaactacagcaaacaaagtgggtcgtttctctgtatcgaaaactgaggacaaa
atcactgacacaaagaaagaaggaccagtggcatctcctccttttatggatttggaacaa
gctgttcttcctgctgtgataccaaagaaagaaaagcctgaactgtcagagccttcacat
ctaaatgggccatcttctgacctggaggccgcctttttaagtagggatgtggatgatggt
tcaggtagtccacactcccctcatcaactgagctcaaagagccttcctatccagaatcta
agtcaaagccttagtaattcatttaactcctcttacatgagtagtgacaatgagtcagat
atcgaagatgaagacttaaagttagagctgcgacgactacgagataaacatcttaaagag
attcaggacctgcagagtcgccagaagcatgaaattgaatctttgtataccaaactgggc
aaggtgccccctgctgttattattcccccagctgctcccctttcagggagaagacgacga
cccactaaaagcaaaggcagcaaatctagtcgaagcagttccttggggaataaaagcccc
cagctttcaggtaacctgtctggtcagagtgcagcttcagtcttgcacccccagcagacc
ctccaccctcctggcaacatcccagagtccgggcagaaccagctgttacagccccttaag
ccatctccctccagtgacaacctctattcagccttcaccagtgatggtgccatttcagta
ccaagcctttctgctccaggtcaaggctgtgcgaagtttaactgtgcatctgaacaggtg
acattcaaacctggtggcaggaggacccgatttctgagtacgccctgcttggctctttgg
aagatggtgaaaaaagtctgtccttgcaaccagctctgtatgtgccctccagcagagccg
aaatcagggaccagcagcacaaacactgttggggcaacagtgaacagccaagccgcccaa
gctcagcctcctgccatgacgtccagccggaagggcacattcacagacgacttgcacaag
ttggtagacaactgggcccgagatgccatgattctctcaggcaggagaggaagcaaaggg
cacatgaattatgagggccctggaatggcaaggaagttctctgcacctgggcaactgtgc
atctccatgacctcgaacctgggtggctctgcccccatctctgcagcatcagctacctct
ctaggtcacttcaccaagtctatgtgccccccacagcagtatggctttccagctacccca
tttggcgcccaatggagtgggacgggtggcccagcaccacagccgattggccagttccaa
cctgtgggaactgcctccttgcagaatttcaacatcagcaatttgcagaaatccatcagc
aaccccccaggctccaacctgcggaccacgtag

DBGET integrated database retrieval system