KEGG   Chlorocebus sabaeus (green monkey): 103218404Help
Entry
103218404         CDS       T04361                                 

Gene name
PARP11
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 11
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103218404 (PARP11)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     103218404 (PARP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE
Motif
Other DBs
NCBI-GeneID: 103218404
NCBI-ProteinID: XP_007965451
Ensembl: ENSCSAG00000011139
UniProt: A0A0D9RFG2
Position
11
AA seq 338 aa AA seqDB search
MWEANPEMFHKAEEFFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSS
EDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICEN
EAIPMPPHWENVNTQVPYQLIPLHSQTHEYNEVANLFGKTMDRNQIKRIQRIQNLDLWEF
FCRKKAQLKKKRGVLQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARD
AAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSK
DGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaagcgaatccggagatgtttcacaaagcagaagaattcttttctaaaacaaca
aacaatgaagtggatgacatggacacatcagatacccagtggggctggttttacttggca
gaatgtgggaagtggcacatgtttcagccggataccaacagtcagtgttcagttagcagt
gaagatatcgaaaaaagcttcaaaacaaacccttgtggctccatttcttttactacttcc
aaattcagctacaagatagactttgcagaaatgaagcaaatgaatctcaccactggaaag
cagcgcttaataaaaagagcccccttttctatcagtgctttcagttacatctgtgaaaat
gaggccatccctatgccaccacactgggagaatgtgaatactcaagtaccatatcagctt
attcctctgcacagtcaaacacatgaatataatgaagttgctaatctctttgggaaaacg
atggatcgcaaccaaattaaaagaattcagagaattcaaaacctagatttgtgggaattc
ttttgcaggaaaaaggctcagctcaagaaaaaaagaggtgtgcttcagattaatgaacaa
atgctatttcatggtaccagcagtgaatttgtagaagcaatctgcattcataactttgat
tggagaataaatggtatacatggtgctgtctttggaaaaggaacctattttgctagagat
gctgcttattccagtcgtttctgcaaagatgacataaagcatggaaacacattccaaatt
catggtgtcagcttgcaacagcggcatctgtttagaacatataaatctatgtttcttgct
cgagtgctaattggagattacataaacggagactccaaatacatgcgacctccttccaaa
gacgggagctatgtgaatttatatgacagctgtgtggatgatacctggaacccaaagatc
tttgtggtttttgatgccaaccaaatctatcctgagtacttgatagactttcattga

DBGET integrated database retrieval system