KEGG   Chlorocebus sabaeus (green monkey): 103218635Help
Entry
103218635         CDS       T04361                                 

Gene name
HLCS
Definition
(RefSeq) holocarboxylase synthetase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00780  Biotin metabolism
csab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    103218635 (HLCS)
Enzymes [BR:csab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     103218635 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     103218635 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     103218635 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     103218635 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_N BPL_C
Motif
Other DBs
NCBI-GeneID: 103218635
NCBI-ProteinID: XP_007965876
Ensembl: ENSCSAG00000008541
Position
2
AA seq 874 aa AA seqDB search
MLITLCYLYLWARWGRRPAELVRATVRRLRASRCSFTFCGAAAQPPGARVCLSRGGRVFC
VSDSQSIEDLNKWALFLVSPFILEAEHIAFVTESIWVQSENLQRSSSSSETIVKWSDCCL
PLACRPGDPYRLIAEASVDNFSKLGVALMEDRLHMDNGLVPQKIMSVRLQDSTLKEVKDQ
ASNKQAQILEPKPEPSLEIKPEQDGMEHVGRDDPKALGEEPKQRRGSASGSEPAGDSDRG
GGPIEHYHLHLSSCHECLELENSTIESVKFASAENIPDLPYDYSSSLESVADETSPEREG
RRVNLTGKAPNILLYVGSDSQEALGRFHEVRSVLADCVDIDSYVLYHLLEDSALRDPWTD
NCLLLVIATRESIPEDLYQKFMAYLSQGGKVLGLSSSFTFGGFQVTNKGALRKTVQNLVF
SKADQSEVKLSVLSSGCRYQEGPVRLSPGGLQGHLENDDKDRMIVHVPFGTHGGEAVLCQ
VHLELPPSSDIVQTPEDFNLLKSSNFRRYEVLREILTTLGLSCDMKQVPALTPLYLLSAA
EEIRDPLMQWLGKHVDSEGEIKSSQLSLRFVSSYVSEVEITPSCIPVVTNMEAFSSENFN
LEIYRQNLQTKQLGKVILFAEVTPTTMRLLDGLMFQTPQEMGLIAIAARQTQGKGRGGNA
WLSPVGCALSTLLISIPLRSQLGQRIPFVQHLMSVAVVEAVRSIPKYQDINLRVKWPNDI
YYSDLMKIGGVLVNSTLMGETFHILIGCGFNVTNSNPTICINDLVTEYNKQHKAELKPLR
ADYLIARVVTVLEKLIEEFQDKGPNSVLPLYYRYWVHSGQQVHLGSTDGPKVSIVGLDDS
GFLQVHQEGGEVVTVHPDGNSFDMLRNLILPKRR
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcacgctgtgctacctgtacctgtgggcgcgctggggtcgccggccggctgag
ctcgtgcgcgccacggtgcggcggctgcgcgcctcgcgctgctccttcaccttctgcggc
gcggctgcgcagccccccggcgcccgcgtgtgcctgagccgcggcggccgcgtcttctgc
gtcagcgacagccagtccattgaagacttgaacaagtgggctttatttcttgtgtctcct
tttatacttgaagcagaacacatagcatttgtgacggagagcatttgggtacaaagtgag
aatttacagagatcatcctcttcttcagaaactattgtcaagtggtcagactgttgtttg
ccattagcttgcagacctggggatccttatcggctaattgctgaagcaagtgtggacaac
ttcagcaagctgggggtggcgctcatggaagatagactccacatggataatggactggta
ccccaaaagattatgtcggtgcgcttgcaggactccactctgaaggaagttaaggatcaa
gcctcaaacaagcaagcccagatcctagagccgaagcctgaaccttctctcgagattaag
cctgagcaggacggtatggagcacgttggcagagatgacccaaaggctcttggtgaagaa
ccgaaacaaaggagaggcagtgcctctgggagtgagcctgctggggacagtgacagggga
gggggccccattgagcattatcacctccatctgtctagttgccacgagtgtctggaactt
gagaacagcaccattgagtcagtcaagtttgcatctgccgagaacattccagaccttccc
tacgattatagcagcagtttggagagtgttgctgatgagacctcccctgaaagagaaggg
agaagagtcaacctcacaggaaaggcgcctaacatcctcctctatgtgggctccgactcc
caggaagcccttggccggttccacgaggtccggtccgtgctggctgactgtgtggacatt
gacagttacgttctctaccacttgctggaggacagtgctctcagagacccgtggacggac
aactgtctgctgttggtcattgccaccagggagtccattcccgaagacctgtaccagaag
ttcatggcgtatctttctcagggagggaaggtgttgggcctgtcttcgtccttcaccttt
ggtggctttcaggtgacaaacaagggtgcactgcggaagacagtccagaacctggttttc
tccaaggctgaccagagcgaggtgaagctcagcgtcttgagcagtggctgcaggtaccag
gaaggccccgtccggctcagccccggtgggctccagggccacctggagaatgatgacaag
gacaggatgattgtgcatgtgccttttggaactcacgggggagaagctgttctttgccag
gtgcacttggaactacctccgagctccgacatagtgcaaactccagaagattttaacttg
cttaagtcaagcaattttagaagatacgaagtccttagagagattctgacaacccttggc
ctcagctgtgacatgaaacaagttcctgccttaactcctctttacttgctgtcggctgcg
gaggaaatccgggatcctcttatgcagtggcttgggaaacacgtggactccgagggagaa
ataaaatccagccagctctctcttagatttgtttcatcctacgtgtctgaagtagaaata
accccatcttgtatacctgtggtgaccaacatggaggccttctcatcagaaaatttcaac
ttggagatctatcgccaaaatctgcagaccaagcagctggggaaagtaattttgtttgcc
gaagtgacccccacaacgatgcgtctcctggatgggttgatgtttcagacaccgcaggaa
atgggcttaatagcgatcgcagcccggcagacccagggcaaaggacggggagggaatgcg
tggctgagccccgtgggatgtgctctttctactctgctcatctccatcccactgcgatcc
cagctgggacagaggatcccgtttgtccagcatctgatgtccgtggctgtcgtggaagcg
gtgaggtccattcccaagtatcaggatatcaacttacgagtgaagtggcccaacgatatt
tattacagcgacctcatgaagatcggcggagttctggttaactcaacgctcatgggagaa
acatttcatatacttattggctgtggatttaatgtgactaacagtaaccctaccatctgc
atcaacgacctcgtcacagaatacaataagcaacacaaggccgaactgaagcccttaaga
gccgattatctcatcgccagagtcgtgactgtgctggagaaactgatcgaagagtttcag
gacaaagggcccaacagcgtccttcccctttattaccgatactgggtccacagtggtcag
caagtccatctgggcagcacagacggaccaaaggtgtccatcgttggcctggatgattct
ggcttcctccaggttcaccaggagggcggcgaggttgtgactgtgcaccccgatggcaac
tccttcgacatgctgagaaacctcatcctccccaaacggcggtaa

DBGET integrated database retrieval system